Identifiers and Description

Gene Model Identifier

Contig18489.0.g67

Standard Name

None

Aliases

Contig18489_0_g67

Description

Eukaryotic aspartyl protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001283206.00073507697681e-75Eukaryotic aspartyl protease f
amily protein
SGDYPL154C2.9997246065828143e-59PEP4 SGDID:S000006075, Chr XVI
from 260931-259714, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18489.0.g67(coding)
ATGTAAAAACTTGCCCTTATCCTACTTTTGGCCTCCTCTGCTTTAACTGCAAAGGTTCCT
CTCATCAAGAAATCAATGACCAAGCAGCAATATCATGCTTTCAAAGACAGAGTTGAGTCA
GGTACCTACCAACCTAAGTTCCTTGATACTGGTGTTGAGCATCACATTCCAGTTAAGGAC
TTCATGAACACTCAGTACTTCGTGGATGTTGAGATTGGTACTCCACCTCAGAAATTCACA
GTAGTCCCCGACACTGGTTCATCAAACCTTTGGATTTACTCAAGTAAATGCACAAATGTT
GTTTGCTGGTATCACGATAAATATGATGCCTCTAAGTCATCTACCTACAAGTCCAATGGT
GAGAAATTCGACATTACTTACGGTTCAGGCTCCATCAATGGATTTGTGTCTGAAGATGTT
ACCTCTTTTGGAGGTGCTACCTCAAATATGCAATTCGGTGAAATCGAAGCTGTATCTGGG
CCATCTTTTTACGCCTCTCAAATGAGTGGTATCCTAGGTTTGGCTTATGGATCTATCTCA
GTTGACGGTCTCCCAACCTTCATTGATTCAAGCAACTTAACCGATAAGAGTTTCTCTTTC
TATCTTCATGAGAACCCAGAAGCCAGTTATATGACCATTCCAGGCTATGATGAAGAAGCC
ACTAACGGTGTAGAATTCTAATTCCATAATGTTGTTGAGGAAAGATACTACTCACTCCCA
TTGACTGGAATGAGAAATGATGACACTCAAATTGATACAACTGGCTACAAGGCTGTTATT
GATTCAGGTACCTCAATCTTGGTAGGACCTCAACCCCTTGTTAAGCAACTTATCGAAGGT
ATCGTTGTTAACCCAGACTGCTCAAACTTGAAAGATCTCCCAGAGATTGCTTTCTAAATT
GAAGGTGTTGAGTATCCTCTTTCCCCAGAGGAATATGTTCTTCAAATTACTGAGGGTGGA
TAAACTGAGTGTGTTATTGCTGTTATGGGACAAATCTTTCCAGATAGCTTCAACTACTTC
ATTCTCGGTGATACTTTCATGAGAAAGTACTACTCCTACTTCGACAAGAATAACAACAGA
GTTGGATTCATTATTAGAGACAGCCTTAAACACTGA


>Contig18489.0.g67(protein)
MQKLALILLLASSALTAKVPLIKKSMTKQQYHAFKDRVESGTYQPKFLDTGVEHHIPVKD
FMNTQYFVDVEIGTPPQKFTVVPDTGSSNLWIYSSKCTNVVCWYHDKYDASKSSTYKSNG
EKFDITYGSGSINGFVSEDVTSFGGATSNMQFGEIEAVSGPSFYASQMSGILGLAYGSIS
VDGLPTFIDSSNLTDKSFSFYLHENPEASYMTIPGYDEEATNGVEFQFHNVVEERYYSLP
LTGMRNDDTQIDTTGYKAVIDSGTSILVGPQPLVKQLIEGIVVNPDCSNLKDLPEIAFQI
EGVEYPLSPEEYVLQITEGGQTECVIAVMGQIFPDSFNYFILGDTFMRKYYSYFDKNNNR
VGFIIRDSLKH