Identifiers and Description

Gene Model Identifier

Contig18398.0.g12

Standard Name

None

Aliases

Contig18398_0_g12

Description

Proteasome subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000304401.9997255150861791e-53Proteasome A-type and B-type f
amily protein
SGDYJL001W5.0020095550341075e-51PRE3 SGDID:S000003538, Chr X f
rom 435163-435227,435344-...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18398.0.g12(coding)
ATGATGATGTCTTTTGCTGATCTCTAAAATGAGATCATCCCTGAAGTTAACACTCACTCA
ATCCAAACCGATGGAACAACTATTATCGCTGTGAAATACGACGGAGGTATTCTTTTGGGT
GCTGATGGTAGATCCGCTAATAACATGTACGTTGGTAACAAAGTCTCAGATAAGCTAGAA
CCAATTCATCAAAGAATTTACTGCCAAAGATCTGGTACCTCATCACACACAAGTGCTATT
GCCAGATACGTGAGATACTATATGGAGATCCAAGCAAACGAGCTAGGCAATCTTCCACCT
GTAGAATCAGCTGCTCAAGTTATGAGAGAAATCATCTACTCAAACAAGAATTCCCTTTCT
GCATCTATGATCTGCAGCGGCTGGGACCCATATAAAGGCTACCAAATCTATCAAGTTAAC
TCTTCAGGTTACTTCGAATAAGGAAACTGGGCTCTAAGTGGTTCAGGTGGTACCTTCATT
TGGGGTTACATCGATGCCAACTACCGCGAGAACATGAGTCGCGCTGAGTGCAAGGAGTTC
ATTAAGAGTTGCATAGCTCTTGCTTGCTTCAGAGACACCTCATCTGGTGGCTGTATCAGA
ATCCTTGATATCACTCAGGACAGAGTTGAGAGAGATTATATTTCATACCCAGAGTTCAAA
ATCAAGTGA


>Contig18398.0.g12(protein)
MMMSFADLQNEIIPEVNTHSIQTDGTTIIAVKYDGGILLGADGRSANNMYVGNKVSDKLE
PIHQRIYCQRSGTSSHTSAIARYVRYYMEIQANELGNLPPVESAAQVMREIIYSNKNSLS
ASMICSGWDPYKGYQIYQVNSSGYFEQGNWALSGSGGTFIWGYIDANYRENMSRAECKEF
IKSCIALACFRDTSSGGCIRILDITQDRVERDYISYPEFKIK