Identifiers and Description

Gene Model Identifier

Contig18292.0.g108

Standard Name

None

Aliases

Contig18292_0_g108

Description

Myosin head (motor domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000464709.997093137033517e-262myosin
SGDYOR326W9.99583921019208e-96MYO2 SGDID:S000005853, Chr XV
from 925721-930445, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18292.0.g108(coding)
ATGTTGACTACCGATGAAATTAAAGAAGTGCTTCAAAACTTTTAAAAATTGGAAGTTTCA
AATCCTTAAGAGCGTAGAAAAACAATGTTTATGGGTCAGAAAATCCAGAAGGATTAGCTA
GTATGGTTTAGAAATGAACAACCAGATGAAAATGATTCAGATAACTCAATCAAGCCCTTC
TATGCAGCAAATATCCTAAAAGTAGCTGGTGATAATCTCGTATTAAAACTATCTCCTTAA
GAATTACAGCCTGGAGTCTCAGAGTGCAGAATTCAAAAATATCTGTCGCCATCTTTCGAA
ATATAAGTAGAAAAAACTATGGAGTACTCTGTGATTAGTGAATAGGGTATTGCAGATATG
GTTGAAATTGATGAACTTAACCATGCTACTTTACTATATAACCTCTACAAAAGATACATA
AAAGATGAAATTTACACTTATGTTGGCCCTATCCTCCTCGCTATGAATCCATTCAAAAAC
TTAGATTATTTATATACTGAAGAATAAGTGCAGAATTATAAGAAAATCATCAACAGTAAA
TAGCCTTATGAAGAGAGGAAAAACATGCCACCACATATCTTTGCTATAACTGCTATGGCT
TTTAAGCAGATGATCGAGAGCAAATAGAAGTAAGCTATAGTAATTAGTGGTGAGTCTGGT
GCGGGAAAAACCGAATCAGCTAAATGTGCAATGAAATTCCTGACTAAACTATCTCAAAAA
GAAAGGAAAAGTGACATGAATCTAAATGGTAGCAGTAGAAATAGTGTGCTAAACAATACA
CAAAATTTATAATAACAATTACTTTAATCAGACAATTTGATGCAATAGATTGATGCTTCC
TTGTTACAAACTACAGGCATTGAATAGAAAATTCTAGACACAAACCCAGTTTTAGAAGCA
TTTGGTAACTCGAAGACTGTCAGAAACAACAACTCTTCTCGCTTTGGTAAATACGTAATA
TTGTACTTTAGTCATCCCAAAGGTGAAATCCTAGGAGCTAGAGTTAAAAATTATCTGTTG
GAAAAGTCTAGGGTTGTAGGGCCTGCACAAGGTGAAAGAAATTATCACGTTTTTTATCAT
TTGCTCAGAGGAGCATCACTTGACTTATTGTAAGACCTTGGGTTGATAAATCAGCTAACA
GGAGACCGCCTAGACTTCTAAGATTTTAATTTCTTGAAAAAGGGTACTGATGTCGATTAG
AAAATAATCAATGACGCTTAATTGTATAAGGAACTGGCTTTGTAATTTTAGAATTTGGGA
TTCACCTAAGAAGAGTAGAGGGCTGTGTGGAGAATAACTGCTGCTTGTTTACATTTAGGG
GAGTTGTCCTTTGATGATTCTACTTATGATGAAAATGGAAAGCCATGCTCAGTTACAAAC
CCTGAAAGAATCCAATTAATAGCCAAAATCCTTGGTATCTAAAACCCACAAGACTTAATT
ACTGAGCTTGTTAATAAACCAAGCACTCCAGGTATATAACTGAGAGCTCCACTAAAGAAG
CATGAATGTGTTGATGCTAGGGATTCTCTTGCAAAATGTCTCTACGATAACCTCTTTAAT
TGGTTGGTCGAGAGAATGAATCTGACTATTCTCCCTGAAACTAGTCTAGATGATGATGCC
TTCAAATTAGAAACTAAAACAATAGGACTTTTAGATATTTTTGGCTTTGAAAACTTTAAA
GAGAATAATTTTGAATAGATGTGCATCAACTATGTCAACGAAAAGCTACACAAACTTTAC
ATTAGCGCTATATTTGATGCAGAAAAATTTGAACTTAGAAATGAAGGTTTAGGAGATAGA
GTGAATTAATTAAAGTACCCTGATCTAACTAGTCTTGACGTAATAAAACTACTTGATGAA
AAATTACAGACAGGTTTCAAAACTGGTGGGAAAGCAGGAGATGCCAAAATAGGTATTTTT
AATATAATTAATGATTGCAGCACTTAGAAGCCCAGACCTACTTGGGAAACTTTAATAAAA
CGAATTGATGATATGCACAAAAATACTTCTGAAAACAGTGTCTACAACAGGGAGAAAGTT
AAGGAAAAATTTAAGATCCGTCATTCAGCGAAGGAAGTAATATACACAGCAAAATAATTC
ATAGAGAGGAATGTTGATGACATTTCAAACTCACTGGAAGGATGTATTTAAAACAAAGCG
GATAGAACCATTGCCATTATTTTCTAAGGTATTACGGGATCTTAATAGAATAATCAAGAG
GAAGAGAAGAAGACTCCAGCTAAGTAAAGTTTTGGGTAGAAAAAGACTATTTGGCATAAG
TTTTCAGATTAAATGTAGGATCTAATGAATGAGCTGGCAGAACCACTTTTGGATTTTAAA
TAGCAGGATGGGTAGACTGATGATATACCGTAGATTAAAAAGGGCTAATCACAATTTGAT
TCTAGTAAAAAGCTTAACACTGCCATTGAAATTGAACCCTGTTCACTACATTTCATACGA
TGCATAAAACCCAATGATTTTAAATAACAAGACCTCTTCATTCATGCCATGTGCCTCCAA
CAAATAACCTATATGGGAGTCTTGGAATCAATTGATGTTAAACAGAAAAATTATCCCTAC
AGAAAGTCCTTCGAGGAATTTTATTAAAGATATGAATTGCTCAGTCCTATTTATGGCACT
ATTCGCTATGAAAACATGACCAAAAGTACAACTGATTTTAAGTAGTTAAGTGTTACTATC
CTAAATGAGGCTTTTTAAGGATTTAAGGAATTTTATGCTGTGGGAAAGACTAAAATATTG
ATGAGAAATGAATGCGTGGCACTCTTAGAAAAAGCAAAGAGTAAATAGAGAGAAGTTAGA
GATAAATCTGCAGTAGTTATTAAAAGAGCTTTTCAAATGTTCTTAGGATTTACTAACACC
CAAGAATAATTAAACAAATCTTTAAGAGATCGATAAAAAATTATTAAGACTATTGAGAAC
TACAATACTATTTAGAGATTGAGGAAGTATTATGTATGTTTTACTATGTCAAGATGGCTG
TTTGATAGAGCTTTTGATATTGGTAAAAGCAGAGCTGAGGAGCGATCTATTAGATTGGTT
CAAAGGATATTTAGAGGTTTTACTGCGAGAGATAAAAAGATGAATTTAGTTGTTAATGCC
CTTAAAGCCAAGGAAAATCTTAAACTGCATGTTGCCGCTAAGCGAGTATAAAAAAGATTA
AGGGGCATGATTGTAAGAAATCGCATGCTGCACCTGCATCTCACAGCCTAGAGAATCCAA
GGTTTTTTCAAGATGAAGTGGCATAAAGAATTTTTCTCTAGTTTAAGAAATAATGTTATT
ACTATCCAGAGAAGCATAAGAAGGTTTTTAGCTAGAAGAGACATTATTAAGTAAAGACTA
GTCAGTTACATAGGCTAAGAACTGAATATCTTAAGAAATGTTAAGTAAATAGAAAACTAC
TAATTATATGGGGCTTAGGCAGATGGAGCAGCACTTCAGGAAATTATTAAACCCCACACT
CCTTATTCAATGAAGAAAATCTAGTTGTTTTTAAAGACTATTGATATGCATATTCTAACA
GATCTACAAGAAATTTACTCTCAACCTTGGTCAACATAGTGGATGAAACTTTCGAAAGAT
TGTCTAGTTGCTGAGAGTCCAATTATGTAACTTTAAGTTGGATCAACTCACACCTTAGCG
ATAAATTAGAAGGGAAGACTGTACTGCTGGGGTTGGAATGATAATGGCTAATGTGCTAAA
AATATCAATGAGTAGTCGGAAGTGATAATAAGGCAAAGTTCTAAAGCAGCCTAAGTCTTT
CTTAATGAGAACCAAGATCAATTTAATTCAGATATAAGAATAAAACAGGTTGTTGCAGCT
CAAGACAGATGCTTAATTTTACTTAATGATTCTTAAGACATTATTGCATGGGGAGGCAAC
GAGAGAGGGTAACTGGGTCTTGGCACTTACGATGACGAATTTATTCCAAAGAGAATTGAT
TTCTTTAGCAAGCAAGGGATTAAGATTAGTGGGATTGCAGCTAGTGGGGACTTGACATTA
TGTGCTTGTGAAAACGGAGAGGGATACGCCTGGCCATTTTAAAGAGGAGGTACAACATTT
AGTCTGCCTGTGAAAATGCCCTTCAGTGAAAAAATTAAGATATCAAGAGTATCTTGTGGT
TATAATTTTGGATTCTTTATATCAACACAAGGCTTGATATACGCATTGGGAAAAGATAAT
TCGGATGGATAATTAGGTTTAGGTCATGTTTACCCAAGAGATGTTCCTGAACTTATCACT
TCATTGAAAGACATTGGTGAACGAATTGATTCAGCTGAGTGTGGATATAGACATGTAATA
GCTAAGAGTACTCTTGGAAAGATTTATACTTGGGGTTGGGGAGCTAAGGGATAACTAGGG
CATGGGCACTATGATTCAGAAATATCTCCACGTTTATTAGTTATAGAGAAAAATAAGCAC
AAGGAAAAGGCCATTTAAATCGCAGCTGGATTTTCGCACTCCCTGATAATGTTAGATAAT
AACAGAGAGTTACTATGGTTTGGTACAAGCGGAAGTTTAAATATGACAAGCAGACCCTAA
ACACTGAGATTAAGTGATATTTTACCAGATTTGTTTCCAGAATAATCACTTATTTCATTC
TCTACTGGCTAACAAATAGACTTTGCTGTTGTAAAGATAATGGGAACTTGGAGTAAAACT
ATGAGTTTAAGTAATATATTAATTGCTGATTTGAGATAAGTTAATGGAGTACAGAGTTGG
AATAAGATTCAAAGCACATTACAGCAGTTAGCTACAAAATGGGATCCAAGAGAAGTAATG
CCACCTTACTTAGACACAGTATCTGGAATGTTTAATTCAAGCATGATGAAAATGACTAAT
GGAACTTCTTCATAGACAAATAAGAACATTGCAAAAGATAAATCACATATAATAGGGGCC
TCTTTCAATCATAATAACGGAAAGAATAGTGGCATCAATCATTCTAAATTGAATTCCAAG
AAAAAGTGA


>Contig18292.0.g108(protein)
MLTTDEIKEVLQNFQKLEVSNPQERRKTMFMGQKIQKDQLVWFRNEQPDENDSDNSIKPF
YAANILKVAGDNLVLKLSPQELQPGVSECRIQKYLSPSFEIQVEKTMEYSVISEQGIADM
VEIDELNHATLLYNLYKRYIKDEIYTYVGPILLAMNPFKNLDYLYTEEQVQNYKKIINSK
QPYEERKNMPPHIFAITAMAFKQMIESKQKQAIVISGESGAGKTESAKCAMKFLTKLSQK
ERKSDMNLNGSSRNSVLNNTQNLQQQLLQSDNLMQQIDASLLQTTGIEQKILDTNPVLEA
FGNSKTVRNNNSSRFGKYVILYFSHPKGEILGARVKNYLLEKSRVVGPAQGERNYHVFYH
LLRGASLDLLQDLGLINQLTGDRLDFQDFNFLKKGTDVDQKIINDAQLYKELALQFQNLG
FTQEEQRAVWRITAACLHLGELSFDDSTYDENGKPCSVTNPERIQLIAKILGIQNPQDLI
TELVNKPSTPGIQLRAPLKKHECVDARDSLAKCLYDNLFNWLVERMNLTILPETSLDDDA
FKLETKTIGLLDIFGFENFKENNFEQMCINYVNEKLHKLYISAIFDAEKFELRNEGLGDR
VNQLKYPDLTSLDVIKLLDEKLQTGFKTGGKAGDAKIGIFNIINDCSTQKPRPTWETLIK
RIDDMHKNTSENSVYNREKVKEKFKIRHSAKEVIYTAKQFIERNVDDISNSLEGCIQNKA
DRTIAIIFQGITGSQQNNQEEEKKTPAKQSFGQKKTIWHKFSDQMQDLMNELAEPLLDFK
QQDGQTDDIPQIKKGQSQFDSSKKLNTAIEIEPCSLHFIRCIKPNDFKQQDLFIHAMCLQ
QITYMGVLESIDVKQKNYPYRKSFEEFYQRYELLSPIYGTIRYENMTKSTTDFKQLSVTI
LNEAFQGFKEFYAVGKTKILMRNECVALLEKAKSKQREVRDKSAVVIKRAFQMFLGFTNT
QEQLNKSLRDRQKIIKTIENYNTIQRLRKYYVCFTMSRWLFDRAFDIGKSRAEERSIRLV
QRIFRGFTARDKKMNLVVNALKAKENLKLHVAAKRVQKRLRGMIVRNRMLHLHLTAQRIQ
GFFKMKWHKEFFSSLRNNVITIQRSIRRFLARRDIIKQRLVSYIGQELNILRNVKQIENY
QLYGAQADGAALQEIIKPHTPYSMKKIQLFLKTIDMHILTDLQEIYSQPWSTQWMKLSKD
CLVAESPIMQLQVGSTHTLAINQKGRLYCWGWNDNGQCAKNINEQSEVIIRQSSKAAQVF
LNENQDQFNSDIRIKQVVAAQDRCLILLNDSQDIIAWGGNERGQLGLGTYDDEFIPKRID
FFSKQGIKISGIAASGDLTLCACENGEGYAWPFQRGGTTFSLPVKMPFSEKIKISRVSCG
YNFGFFISTQGLIYALGKDNSDGQLGLGHVYPRDVPELITSLKDIGERIDSAECGYRHVI
AKSTLGKIYTWGWGAKGQLGHGHYDSEISPRLLVIEKNKHKEKAIQIAAGFSHSLIMLDN
NRELLWFGTSGSLNMTSRPQTLRLSDILPDLFPEQSLISFSTGQQIDFAVVKIMGTWSKT
MSLSNILIADLRQVNGVQSWNKIQSTLQQLATKWDPREVMPPYLDTVSGMFNSSMMKMTN
GTSSQTNKNIAKDKSHIIGASFNHNNGKNSGINHSKLNSKKK