Identifiers and Description

Gene Model Identifier

Contig18220.0.g17

Standard Name

None

Aliases

Contig18220_0_g17

Description

TCP-1/cpn60 chaperonin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001349709.997093137033517e-262TCP-1/cpn60 chaperonin family
protein
SGDYJR064W9.997093137033517e-262CCT5 SGDID:S000003825, Chr X f
rom 555914-557602, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18220.0.g17(coding)
ATGAGTTTAGCTTTTGACGAATACGGAAGACCCTTCATTGTTATTAGAGAACAAGACAAA
AAAAAGAGAATAAAGGGACTCGAGGCCCACAAGGTCAACATTCAGGCTGCCAGAACTGTC
GCAAACTTGATGAGAACCTCCCTTGGACCCAAAGGTATGGATAAGATGCTTGTCAGTCCT
GACGGAGATGTTATTGTCACCAACGACGGTGCTACTATCCTCGACAAAATGGAGGTTGAA
CACCAAACTGCCAGACTTTTGGTCGAACTATCCAACTCACAGGACAACGAAATCGGTGAT
GGTACCACTGGTGTTGTCGTATTGGCTGGCGCTTTACTAGAACAAGCTCAAAGACTCCTC
GATAAGGGTATTCACCCACTTAAAATCGCTGATGGTTTCGAGAAGGCTTGCGATATCGCA
GTTGGAAGAATCAACGACATCCAAGAAGAGATGAACATTGAGAAGAATGATTATGCCTAC
TTGAGAAAGTGTGCTGTTACTGCTTTAGGTTCAAAGGTCGTCAGCAAGTGCCAAGACTTG
ATGGCTGATATCGCTGTTAAGGCTGTCCTCGCCGTTGCTGATCTTGAGAGAAGAGACGTT
AACTTCGATCACATTAAGATCATTGCCAAGACCGGTGGTTCTCTCGAAGATACCAGTTTT
GTTAAGGGTTTAATCTTAGACAAGGACTTCTCTCACCCACAAATGGATAAGGAAGTTAAG
GACGCAAAGGTACTCATCCTTACCTGCCCATTCGAACCACCCAAGCCAAAGACTAAGCAC
GGTCTCGAAATCAAATCAGCTGCTGATTACGAAAAATTATACAAAATGGAACAAGATTAT
TTCACTGATATGGTTAAGAAGGTTAAGGACTCTGGTGCCAACGTTGTTCTCTGCCAATGG
GGTTTCGATGATGAGGCCAACCATTTGCTCATGCATCACAAACTTCCCGCCGTTAGATGG
GTCGGTGGTGTTGAAATCGAGCTCTTAGCTATGGCTACTGGTGCTAGAATCGTTCCAAGA
TTCGAAGAAATCACCCCAGAGAAACTCGGAAGAGCCGGCAGCATTAAGGAAATTGCCTAC
GGTACCTCAAACGATAAAGTTATCTTAATTGAAGAGTGCGCTAACACTAAAGCCGTTACC
ATTCTGATCAGAGGTGGCAGCAAGACTATTTGCGATGAGGCTAGAAGATGCCTTCACGAC
GCCCTCTGTGTTGTTAGAAATATGATTAGAAACAGTAATATTGTTGGAGGTGGTGGTGCC
ACTGAACTCGCCTGCGCCATCGCAGTTGGTAAAGAAGCCGATAAGATTAAGGGTGTTGAG
CAATACGCCGTGAGAGCTTTCGGAGATGCCCTCGAAGAAATCCCACTTGCCCTCGCTGAG
AACTCTGGTTACAACCCAATTGAATATCTCAGCAAGATCAAGAAGGAGCAAACCCAAGAA
AGCAACCCATACATCGGTGTTGACGCCTTAATGAAGGGAACCACTAACATGATGGAACAA
GGTGTCCTCGAGTCAGCTGCCTCAAAGAAGAATCAACTCGAACTCGCCACCCAAGTGGTT
AAGATGATCCTCAAGATCGATGATGTCATCTCACCAGCACTATATGATTGA


>Contig18220.0.g17(protein)
MSLAFDEYGRPFIVIREQDKKKRIKGLEAHKVNIQAARTVANLMRTSLGPKGMDKMLVSP
DGDVIVTNDGATILDKMEVEHQTARLLVELSNSQDNEIGDGTTGVVVLAGALLEQAQRLL
DKGIHPLKIADGFEKACDIAVGRINDIQEEMNIEKNDYAYLRKCAVTALGSKVVSKCQDL
MADIAVKAVLAVADLERRDVNFDHIKIIAKTGGSLEDTSFVKGLILDKDFSHPQMDKEVK
DAKVLILTCPFEPPKPKTKHGLEIKSAADYEKLYKMEQDYFTDMVKKVKDSGANVVLCQW
GFDDEANHLLMHHKLPAVRWVGGVEIELLAMATGARIVPRFEEITPEKLGRAGSIKEIAY
GTSNDKVILIEECANTKAVTILIRGGSKTICDEARRCLHDALCVVRNMIRNSNIVGGGGA
TELACAIAVGKEADKIKGVEQYAVRAFGDALEEIPLALAENSGYNPIEYLSKIKKEQTQE
SNPYIGVDALMKGTTNMMEQGVLESAASKKNQLELATQVVKMILKIDDVISPALYD