Identifiers and Description

Gene Model Identifier

Contig18210.0.g67

Standard Name

None

Aliases

Contig18210_0_g67

Description

Phosphoglucose isomerase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011087009.997093137033517e-262glucose-6-phosphate isomerase
family protein
SGDYBR196C1.000211181581171e-120PGI1 SGDID:S000000400, Chr II
from 613900-612236, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18210.0.g67(coding)
ATGGTAGAATAAACAAAAACAGCTACTACTTATGACAAATTAGACTCAGTCAAGACCCTA
GTCCAACATTACCAAACTGTCACACAGTAAACCCATCTCAGAGAGCTTCTCAACAATGAA
TAACGTAATTCCAAGCTGAGAGCTTCCTTACATAATGAAAAAGAGAAATCAGATGTCATC
TTGGACTTAACTCACATTAAGATTGATGAGGCTGGCATTCAAGCTCTACATTAAGTAGCT
ACTGAAGTTAAACTTCATGATAAAATTGAAGCCTTGTTTAAGGGAGAGAGAATAAATACT
ACTGAAAATAGATCTGTATTACATGTTGCTTTAAGAATGGATGAAAATGAATCATTAATT
GTTCCAGACTCATAAGAAGGTGATGCTGTCAAGAACGTGCATGAAGTTTTAAAAAGAATC
CATTAATTCTCAGAAAAAGTGAGAGGAGGACAAGTTAAGGGATTTAGCGGAAAGAATTTG
GTAAATACCTTGATTATTGGTATTGGTGGAAGCTACTTGGGCCCAGAATTTGTGTTTGAA
GCATTGAGATAAGATTCAAAATCAAAGGAGGGAGCTGAAGGTAGAAGACTTAGATTTTTG
GCTAATGTAGATCCAATTGATTTTAACAGAGCTATGGATGGATTTGATATTGAAGAAACC
CTTGTTGTCATTAACAGCAAGACTTTCACTACTGCAGAGACAATTCTTAATGCTTAGACT
GTGAAGAATTATATCATTAATCATTACAAGAAGCTTCACCCTGATGTTGTCGATACACTT
CCGTTCGTTCAAGCTCATTTCTGTGCAGTCAGCACAAATCTTCCTTTGACTTCTCAATTT
GGAGTAGCTGATGATAGAGTATTCGGCTTCTGGGATTGGGTTGGTGGTAGATTCTCGGTA
TGCTCAGCTGTTGGTGTCTTGCCCTTATCTCTTCACTATGGCTATGAAAATGTTCAAAAT
TTCCTATCTGGAGTAAAATCTATTGACAATCATTTCAGAAATGAGCACGATCTATCAAAG
AATCTTCCAGTCCTTCTTGGGCTACTAGGTTTCTACAATACCCATGTAGCAGGCCACAAC
ACCAGAGCTATTTTGCCATACTGCCAATCTTTGTTGAAGTTCCCAGCTCATATTCAACAA
CTTGACATGGAGAGCAATGGCAAGGGAGTATCCAGAGATGGGACTAGATTTGATGCAGGA
GTAGAAGCAGGTCCAATTATTTTCGGTGAGCCAGGTACCAACGGCCAGCACTCATTTTAT
TAATTGATGCACCAAGGCCGAGTGATCCCAGCTGAGTTCATCGGCTTCGCTAAATCTCAA
ACCCCCACTCACGTTGTGGGACACCCAGTCTCCAATCACAATGAATTGATGTCCAATTTC
TTTGCTTAACCTGATGCCTTAGCACTTGGCAAGACTATTGAATAGTTGTAAGCAGAGAAA
GTACCAGAGCATTTACAACAGCATAAGCTTTTCACTGGTGACAGACCATCTCTATCAATT
CTATTCACAGGTTCGTTAACAGCATACACCTGTGGCCAGCTACTTGGTCTCTATGAGCAC
AGAGTTGCAGTTGAGGGTTTCATCTACGACATCAACAGCTTCGACTAATGGGGAGTGGAG
CTTGGCAAAAATCTCGCTAAAGACGTCAGAAACGTACTTGCAGAGAAGGAAAAAGGCAAC
AGTGTAGATGTTCAAAGCAAATTTAACCCAGCAACTGCTTTTCTTCTAGAAAAATACCTC
AATAATATGTGA


>Contig18210.0.g67(protein)
MVEQTKTATTYDKLDSVKTLVQHYQTVTQQTHLRELLNNEQRNSKLRASLHNEKEKSDVI
LDLTHIKIDEAGIQALHQVATEVKLHDKIEALFKGERINTTENRSVLHVALRMDENESLI
VPDSQEGDAVKNVHEVLKRIHQFSEKVRGGQVKGFSGKNLVNTLIIGIGGSYLGPEFVFE
ALRQDSKSKEGAEGRRLRFLANVDPIDFNRAMDGFDIEETLVVINSKTFTTAETILNAQT
VKNYIINHYKKLHPDVVDTLPFVQAHFCAVSTNLPLTSQFGVADDRVFGFWDWVGGRFSV
CSAVGVLPLSLHYGYENVQNFLSGVKSIDNHFRNEHDLSKNLPVLLGLLGFYNTHVAGHN
TRAILPYCQSLLKFPAHIQQLDMESNGKGVSRDGTRFDAGVEAGPIIFGEPGTNGQHSFY
QLMHQGRVIPAEFIGFAKSQTPTHVVGHPVSNHNELMSNFFAQPDALALGKTIEQLQAEK
VPEHLQQHKLFTGDRPSLSILFTGSLTAYTCGQLLGLYEHRVAVEGFIYDINSFDQWGVE
LGKNLAKDVRNVLAEKEKGNSVDVQSKFNPATAFLLEKYLNNM