Identifiers and Description

Gene Model Identifier

Contig18162.0.g15

Standard Name

None

Aliases

Contig18162_0_g15

Description

Trm112p-like protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007051902.998577119979921e-31hypothetical protein
SGDYNR046W4.0009493637353324e-18TRM112 SGDID:S000005329, Chr X
IV from 707788-708195, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18162.0.g15(coding)
ATGAAGTTGATCACTCACAACATCCTCATGTGCAATAGAAAGGGCTGCAATGGAAATAAT
TTCCCATTAAAACTCGTTGTTAATACCTGGAAAGACCTTGATGCTGAAAACGCACAAGAC
TATAATCCCGCACTTATACAGAGATTGCTTGAGAAAATCGAATGGAATGCTCTCAGATAA
ACAGTCTCAACTTTGGATTGGGGTATGGACTTACCAGAAGTGCTGACTCCAGAGATGGCT
CAAGACGACAAGGTTTTGCAAGATTTGCACAAATTATTGATTCAAAGACAGGTCATTGAG
GGTTAAATGCAGTGCCCAGGGTGTGAGAGAGTATATGAAATTCACAATGGAATCCCAAAC
ATGCTCCTCAAGGAAGACGAAGTATGA


>Contig18162.0.g15(protein)
MKLITHNILMCNRKGCNGNNFPLKLVVNTWKDLDAENAQDYNPALIQRLLEKIEWNALRQ
TVSTLDWGMDLPEVLTPEMAQDDKVLQDLHKLLIQRQVIEGQMQCPGCERVYEIHNGIPN
MLLKEDEV