Identifiers and Description

Gene Model Identifier

Contig18091.0.g12

Standard Name

None

Aliases

Contig18091_0_g12

Description

Putative zinc finger in N-recognin (UBR box)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam02207 ) Putative zinc finger in N-recognin (UBR box)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005822801.000382677035467e-28Zinc finger in N-recognin fami
ly protein
SGDYGR184C0.0000000006000548789370351UBR1 SGDID:S000003416, Chr VII
from 865753-859901, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18091.0.g12(coding)
ATGGTTAGAACAGACTAATCACAAATACCTTCAATTCTTGATGAAACATTTCAAGAATTA
TATAACGAAATGACTTAAAAAGTGAACGAGCAGTTATTTGTTAAGCATTTTGAGCCTTTC
TTCAAACAATGCAAGATCTTCTTGTATGGATAGATTAACTTCGAAATAGCAGCTGCTGAA
TTGAAAAAAGCTCAAAATGGATCAAAAGGAGGTGTATGCGCTAAAACTCTAAAAGCAGGA
GATGTAGCTTGGAAATGCGAAGACTGTGAATTAGACCCAACTTGCATTATCTGTCAGGAC
TGTTTCGAAAAAGGTAATCACAAGGGTCACAGAGTTTGGCTGAAGAAAAATGTGAGTGGA
TGCTGTGATTGTGGAGATCCTGATGCTTGGCGGGAAAACGGCTTTTGCTCTGATCACAAG
GGATATGAAGCAAGCAGTGAAGCTCTTATGGAATCCATGCCTATGTTTATGAAAAACAGT
GCAAAGCATGTATTTGAATTCATTTGCAAGTAATTAAAACTATAATGCTTAAATCTTCAG
CACTTCCAAATCTAATTTAAATAGGGCATGAAGAGTGAAGAGTTGATTGCTAAAATATTC
ACCACTGGTCTATTAATAATTGAACTTTTTAAATTCTTCGAATGGTCCATTGAGGCGTCT
CCTGCATTAATTAATTTTATCACTGAGGCAATTGGGCAGACATATTTTGATAGTATTAAG
CCTAAAGAAAGTCATAAATGCTGCTATAGAGGGTTTATAAATGAAGAGGAGAAGAGATAA
TACCTAATGAAAGTTAAGGGATATTTGGATGAATTGAATATTGAAGAAGAAGATCCAATT
GATAGCAATCTTTCTTAAATTACCCAAGATGATGAATACCAAAGATTAATGAAAAAATTA
GCATTAGCTATAGACTTAAAGAAAATTTGTGTCTGCAATTCACTTGACCTAACTTTTTAA
ACTAATCATTTTATGCTGCCTGCCTAAAAAACTTAGATATATGAGTTCTACTTTAAACTC
TTCCAGAGCTTTAAATTTAAATAACTTTTGGGTTTAAGTTTTGCCGCAAACTTTGAAGTC
ATAACTATCGAAAGGCCTGATTCACATCACAACATAGGATCTATTGGTGTTTAGATTTTG
ACTATAGATGAAATAGGGCTTATGATAATGAAAGAAGCTTAATACAGATAATGCATTATT
AATACTTATGATAAAGTTATGAATTAGATGATAGAAAGTGACTATAACGAAAAATATGCA
AACTTCTACTTCCATATGTTGTTCGATTTGAAGTACCTCTGCAGACCTAAGACCCTTAAT
TACATAATATATGAGACTACTTTCTTAGAGAGTATCTTGGAGTAATTAATCAAGTTTTAC
TTCACTGATACTGTTTCGTTCAGGGAAACTCATGTCATGTTTGATTCAGCTGTTTACAAA
GAAAGCTTGATTAACATCGATATATAGCTTTCAAAGATCTATAAGGGCTATTTGAAGGAA
TTAGACCCAAGTAACCTTCAAAGAAATCGAAGATTAATGAGTGCTTTTATTGTTTATTTC
TAGGACATCAATGAAAGATTTGCATCACATTTAAATAAAGGGTTCTTTTGTATACCATTG
CACAGAGCTTTTAGTTATTACTTATCGAGATTGGTTATGTATAACTATATCAAAGATAAG
GAAAGATTTCAACATAAGAAACCCAAAGATATAATGGTTGATATAATGAGGAAGTATGTT
GAATGCAAACCAGGCCAAAATGTTTTGAACTATATTCAGAGTGCGATTACATCAATAATA
TGCCCTCTAGCAGCGCAATGGTCCTTTAATCATTAAATATTAAGTGGTAAATGGGTCATG
TCTGGTCTATATATCAATCAGTTACCTAGACTAATATACATGGTTTTTGAATATTACTTG
CTACTTGAAATGGGGCTGTTTTAACTTTTAATAGCTGTTAGCCCTGAGCCTGAATAAACC
ATTAATAATATATTGCAGACTTTCGAACTTGACAGCTGGATGAAGACTTTATATCAGAAC
ATCTGTACAAAATCACTGAGCGCAGATGCATTCAAACAATTCAAACCAGTATTCGATGTG
AAAAAGTTGCGTTAAATGCTTCATTGGCAATTTAGGTTTCTCATTCAATTAAGTTAAACA
GAAATAGGCTTTCTTTATCCACTATTAACTGACTTAGAAAGAAAGGACCCCTTATTTTAT
CAAGAAGAGAAAATCACTAAATAAATAGAAGGTATGTTTAAGAAGGATTTGAGAAGGAAT
ATCATCCACACCCTGATTCAATTTGCAGGGAGAGCTGACATTAAGGATCTTAAAAAAGGT
TCTGAAAAACTTTACGTAGAATCAAGCTATTACGAAGATGCTTTGTTAGAGGTAGCTGAG
CCTTTGAAAGATAAATCTAAACTTGCCTTATTTAAATTGAAGGATCAATACTTAAACTAA
TTTGAACCATATTACTACATGAACCCAGAAAGTATAGCTAAAGTGACTGAGTCTGTTTAA
AATATGCAAAACGAAAAGTAAAAATAAAATGACATCCTTGGTGATTACTAAGGAAATTAT
ACATTTTCAACTGACATAAACAATTTAGTTAGAGATGCCTTAACTCAGAGTACTTTTGCT
ACATATCTCAAAGAATTTTTAGTCATTTGGACTTCAGAAAAGAAATAAGATTTCGAAGTA
ATTGATGAATAAGTTGGACATGAATGCTTAAAGCTGTTATGGCTAATGATTTGCTCAGCA
TAGTAGAACACTTATAATCAGAAAAACTTCTTAGTCTAAGTTTTGCTATCAAATGATAGT
GAGGTTATAACCTCACTCTTGAAATTGAAAGAATAAGGAGAAGCAATGAATACAGCTGTT
GATATTATCTTAAGAGGAATCTATGACATTGATCCAATTTAATTTGTTGAACTTGGCCAG
AAATTAGGAATTAACGATTAAGAATTGAAACAGCAAAACTAAATCAGCTAGTAATTAAAG
GAAGAAGAGTAAAAACAAAAGAAGGAGACTATGAAGGAAGCTGCTAGATTAAAGAAAGAG
CAAATTATGTAGAAGTTTCAAGGGAAAAGGTAGAATTATATTTCCAAGTAGAGTTAGTCA
TCAATTTCTGTTTAATTAAATAGGACAAATAGCTCTATGACTGAAAAGATATCGCTTGAG
GATGGAGAAACAAATCACTGCTCTCTTTGCAAAGAAGAATTAAGTCTGGATAATTTCTTC
TCCGAACCATACGGTTAATTCGCGTATCTCTCAAGATCAAAACTTATGTCTCATACTTTG
AAGTAAACCCTATAACTTCAAAATGAAATAATCTCTAAATTCAATACCAACTGTTATCAG
TAGAGTAATGATAATATTCAAGAATAAAATCAAGTTGAAGAAGAGAAAGAATCTTATTAA
TAGTAAATTAATGATTAGGTAACTGAAGAAACTTTAAGAACCTTAGATTTGAGTTATTTA
ACTGAGCATTAAAAAACAGGTGGTACCATAATAAAATGTAGTCACTATTCTCACTATAAA
TGCCTGAATGACTATTTGATTACTAATGAGTCAGATATAAGGAAAAGAGAGAGCAGGAAA
TTAATAGGGTTAGATTTTAATAACTTTCAATGCCCACTCTGCAGACATCTATCTAATGGT
CTAATTCCATGTGATACTTTATAAAACTACAACGAAAGAAAATTTGATCAATCAGATTTC
AATCAAATTGATCTCCTGCAAATATACTCAAATTTCTTGTCAAAGATATTTAAAAGCTAA
ACTAAAAGAAGGTCTGATACTTTACTTATAGATATCAAGAAAGAACCTCTTGAAGCACTG
GAGGTGGTTTCAGATTTTATAGAGCATAGACTTTAACTCATAGATATAAAAGGTACTCAA
GAATTCTTAAAGCCAAGTAAACATCATGTTAACAGGGATTAATATGAAACTATTCTCGAT
ATGACTTACAACTTGGTGAAGATTGTTATGGATTCAGGGATAAATCTAAGGGGAGACAAT
TCGTAAGATGAAGATATGACTGAGTTTACATTCGATGAGATTTGTGTTGAGAAATTGAGA
AAATTACTCGAAAAACACACCAGTAGCTCGAATTAAAATATACTCTTTTAGACCGATTTA
TTTAGCCATGCTTTCAAAGTGCTATACTTTATTTACATGCTTTTCCAAGAAAAGTAAGGT
GAATTCTTGGGCTTGATGTAAGAAGTAATATCAGCAGTTTATAAATTAAATTAAGTTCAA
GCCTTGCTTAGAATTATGTTTATGGTAAATAAAGGGCAATTAAATGGCACAAATTCCTAT
ATCTATCAACAATTTGACGCCAATAATTTGTATGAGCTTTCTAAGAAACCAGAATTACAA
GAGTATCTTATAAGGGCTCAATTACCATTCTTAAGAAAAGTCATGTGTTTGAAAGTAATG
ATGACTTAAAGATTTGCATTTAATGACCCTCAACTTCATACAAATAATAATCAGATAATA
GATACACTTCTTCACATTCATGATGATCATGATGAATATGAATTCTTAAGAGCTTAATTG
AATCTCAATGATTTCAATTACGATTTCTTGATTAAATAGGAACAAGGCTCTACCAACATA
AAAGCTCAATAATAAGCAGACAATAATATGGAGGAAGAAAGTGCATTTGATGACCCCTCA
AATTACTACTAGATAGAGTCATTAGAATGTCAACTTAGCACATCTAAAGATGAGCTTTCA
AATTTGATTAAACAGTCTCTATCAAAGATAAGTGCACTCGATTTCATTAAAAAACAAATA
GACGATTGGGTTGTCTTTAGTTAACTTGGCTTTGCTAATTTTGCTAGATTGAGCAAAGAA
TAAATATTGGAATCAGAATATGCTAAGACGCTTTATATGCCAAATTAATTGAAGCTGCAA
GATACTTACTTCACTTTCAAATTGAAATAGTTACCATAAGACTTCTAGAGCTTAATTCAA
GAGTATTACAAGTAAAAATGCAAAAACTGCAACAAGTAACCAAAAGAAGCATGTCTTTGT
TTACTCTGTGGTGAAACACTTTGTTTTGTTTAAAAATGTTGCTAAAACCTACCAGGCATG
AGAGATATGGAGGGCGATTTAACTTTCCATAGCAGGACTTGTGAGGGAGGAATGAGTCTT
TTTATCAATATTTCAAGTGGAAAGATAGTGTTTATTGAGGGAGATAGATCATGTCAGAAA
AATTCTCCATACATAAACAAATTTGGAGAAACTTACAGTAACTCTTCAAAGAAATGGGAT
AATTTCTATTTGGATGAGTCGACTGGAGGAGCGCAAATATATGAAGATTACAGAAAAATG
TACATGAATTTCACTATAAGCAATGAGATTATTAAATATAGAAGCAGCAATGACTATGTA
TGGAGATTGAGGATGGTCTGA


>Contig18091.0.g12(protein)
MVRTDQSQIPSILDETFQELYNEMTQKVNEQLFVKHFEPFFKQCKIFLYGQINFEIAAAE
LKKAQNGSKGGVCAKTLKAGDVAWKCEDCELDPTCIICQDCFEKGNHKGHRVWLKKNVSG
CCDCGDPDAWRENGFCSDHKGYEASSEALMESMPMFMKNSAKHVFEFICKQLKLQCLNLQ
HFQIQFKQGMKSEELIAKIFTTGLLIIELFKFFEWSIEASPALINFITEAIGQTYFDSIK
PKESHKCCYRGFINEEEKRQYLMKVKGYLDELNIEEEDPIDSNLSQITQDDEYQRLMKKL
ALAIDLKKICVCNSLDLTFQTNHFMLPAQKTQIYEFYFKLFQSFKFKQLLGLSFAANFEV
ITIERPDSHHNIGSIGVQILTIDEIGLMIMKEAQYRQCIINTYDKVMNQMIESDYNEKYA
NFYFHMLFDLKYLCRPKTLNYIIYETTFLESILEQLIKFYFTDTVSFRETHVMFDSAVYK
ESLINIDIQLSKIYKGYLKELDPSNLQRNRRLMSAFIVYFQDINERFASHLNKGFFCIPL
HRAFSYYLSRLVMYNYIKDKERFQHKKPKDIMVDIMRKYVECKPGQNVLNYIQSAITSII
CPLAAQWSFNHQILSGKWVMSGLYINQLPRLIYMVFEYYLLLEMGLFQLLIAVSPEPEQT
INNILQTFELDSWMKTLYQNICTKSLSADAFKQFKPVFDVKKLRQMLHWQFRFLIQLSQT
EIGFLYPLLTDLERKDPLFYQEEKITKQIEGMFKKDLRRNIIHTLIQFAGRADIKDLKKG
SEKLYVESSYYEDALLEVAEPLKDKSKLALFKLKDQYLNQFEPYYYMNPESIAKVTESVQ
NMQNEKQKQNDILGDYQGNYTFSTDINNLVRDALTQSTFATYLKEFLVIWTSEKKQDFEV
IDEQVGHECLKLLWLMICSAQQNTYNQKNFLVQVLLSNDSEVITSLLKLKEQGEAMNTAV
DIILRGIYDIDPIQFVELGQKLGINDQELKQQNQISQQLKEEEQKQKKETMKEAARLKKE
QIMQKFQGKRQNYISKQSQSSISVQLNRTNSSMTEKISLEDGETNHCSLCKEELSLDNFF
SEPYGQFAYLSRSKLMSHTLKQTLQLQNEIISKFNTNCYQQSNDNIQEQNQVEEEKESYQ
QQINDQVTEETLRTLDLSYLTEHQKTGGTIIKCSHYSHYKCLNDYLITNESDIRKRESRK
LIGLDFNNFQCPLCRHLSNGLIPCDTLQNYNERKFDQSDFNQIDLLQIYSNFLSKIFKSQ
TKRRSDTLLIDIKKEPLEALEVVSDFIEHRLQLIDIKGTQEFLKPSKHHVNRDQYETILD
MTYNLVKIVMDSGINLRGDNSQDEDMTEFTFDEICVEKLRKLLEKHTSSSNQNILFQTDL
FSHAFKVLYFIYMLFQEKQGEFLGLMQEVISAVYKLNQVQALLRIMFMVNKGQLNGTNSY
IYQQFDANNLYELSKKPELQEYLIRAQLPFLRKVMCLKVMMTQRFAFNDPQLHTNNNQII
DTLLHIHDDHDEYEFLRAQLNLNDFNYDFLIKQEQGSTNIKAQQQADNNMEEESAFDDPS
NYYQIESLECQLSTSKDELSNLIKQSLSKISALDFIKKQIDDWVVFSQLGFANFARLSKE
QILESEYAKTLYMPNQLKLQDTYFTFKLKQLPQDFQSLIQEYYKQKCKNCNKQPKEACLC
LLCGETLCFVQKCCQNLPGMRDMEGDLTFHSRTCEGGMSLFINISSGKIVFIEGDRSCQK
NSPYINKFGETYSNSSKKWDNFYLDESTGGAQIYEDYRKMYMNFTISNEIIKYRSSNDYV
WRLRMV