Identifiers and Description

Gene Model Identifier

Contig17998.0.g14

Standard Name

None

Aliases

Contig17998_0_g14

Description

Tubulin-tyrosine ligase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003787508.00224171858215e-126Tubulin-tyrosine ligase family
protein
SGDYBR094W0.00000000009998509410508463PBY1 SGDID:S000000298, Chr II
from 432036-434297, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17998.0.g14(coding)
ATGACATCAAGTAATAATAAGCCCCCTTTGTTATAAAGAAATTCATATTTTGATAATGCT
AAGAATTTCGATTCTGACGAAAAAGACTAAAAGGAAGAATAAATTCAAGCTAAGTAGTTA
TTAAACAATTTCACAAATGCAGCACTGACAACCCCTTAATCGGCATAAAAGCAGAGGAAG
CAAAACGACTTTTAGATAAAAAATTATGCTAAGAAATGTGGGTCAAGTCTGATATCAATG
GATTAAAATAATATGAGATCGCTATCATAAACTGTAAAAGCATATACAGATAATTAATAG
GAGTAACACTTGTAAAATGTTCAAATTCCTACTATCAAAACTTGCAAAAATTAATCTAAT
CTTTGGAGCACCTAAACGAATTTCAAAAATAAATTACCAATTCAGATATCTTATTAAACT
CACACAGATTTCAGGAAGAACTCAGTTCAAGAGGATGAAAAGTAAATTCAAAATATTAAT
GCAGGCTCTCAAAAGAATAAAAATATGAATGTCTCTCAAAAAGTTATGAAATATATCGAA
GAACTTGAAAATAAAAAGAAGTAAGCTAGAGACAGAGAATAGTCTGAATAAAAACGAAAA
AATGATATTCTTGTAAATGCTCGATAAGAAGTTCAAAAGAGAAATTATGAACTCATTTAA
CTCAAAAAAAAGAGATATAAACTTTTGCCTGAAACTAAAATCTTTATAGTTGTAGGAAGT
TATCATACATTAAGACAGGCTTTAATTGAGAGAGGTTGGCATGAAAACACTGATAAAAGT
TCAACTATTTTCGATTTAAAATTCGCAATAAAAATGACAGATGTATGCACTCAGGATTTG
CAAGACTTTTAACTTGTAAATCACTTCTTTAAGAATAATTTAATCACTACAAAAACTGGT
TTGTGTCATTCTTTGAAAAATCTCGTGTGGTGGAATAATGTCGAGATTGATGCATTCTTT
CCAAAATGTTTTGATTTGACTGATGATATGGAGATTGAAGATTTCAAAAATGAATATAGA
TTTATAAAGGCTGAGTCTATACTTAAGACATATGTTGCCTAGTAAAGTGTTAATTAAATA
GAGAAATTATTGCTTTCAATCAAGATTTGTGAAAGACGATTAAAAGATATTGATGATCAA
TTAGATGATAAAACATCAGTACTTATAGTTTCAGATATAGAATGGGAATATCTCTAGAAA
GAAATTTTGACTCCAGAACAGCAAATTTCATTGAGGAGCGAGAAATGGTTTTAACTAATT
GAAAATTAATTTTCAGATGAATTTCTTCAATATCAAAAGAATGAAGACACTTAAACTTCT
AACTTATCACAATCAACTTTAGAGGTATAAAAGAGATAGTTTTACCTAACTTATTGTACT
AATATACTTTAGAGATTTTAAGATAAGTTTCCTTAAAATAACATAAATGGTCGCTTTAAT
ACTTGGATTGTTAAACCAGGAGGAAAATCTCGAGGGAGAGGGATAAAAGTTTTTAGGAGT
TATGATAAAATTATGCAGTATGTAAAAGCAGTAAAGGGAAGGTCTTTTATTGTTCAGAAA
TATATCGAGAATCCTCTCATAGTAATGAAAAAGAAGTTTGATATAAGATAATGGGTTCTT
GTTACAGATTGGAATCCACTGACAGTTTGGATTTATAAAGAATGCTACATCAGATTCTCA
CCAATCGACTATGATATTACAAAGTTAAATGATAAATTTATGCATCTAACAAATAACGCA
ATAGTATCAAAATCTGAAAAGTTTTATGAGAGTGAAATTGAAGGCAATATGTGGAGTTGT
GAATAATTCAGCAGCCATCTATAAGAAACCTATTAAAAGGATGTGTTTTAAGATGAGATC
TGGCCATAAATTCAAAAGTATGTAACTTGTAGTTTATAAAGTGTTCAAGACATGGTTGAA
AATAGAAAGAACAGTTTTGAGTTTTTGGGGTATGATTTTATGGTTGACGAAGATTTAAAA
GTTTGGCTCATCGAAGTTAACTCATCTCCCTCTATGGATTTGTCTACAAATGTAACTGAA
AGATTAGTGAAGCTAGTCTTAACAGACTTGCCTAAAGTTATTCTTGACTATCCTAAAGCA
AAAAAGAAAAAGGAATGTGATACTGGAGGTTTCATTCTATGCCACAAAGCAAAAATTTAA
GTAGACAGACCAAAGGATGCTATGAATCTTAATCTTCTGTCACTTTAATAAGTAATCAAG
CCAGCTGCTAAAATTGAAGAAGACGAAGATCTAGATGAGTTCAGATAAGATGATTGGGGT
AAGGAATTCAAAAGCGGGTTTTAAGAATTAGAAGACGATAAATACTGGATGAAGTAATGG
GACAAAACTGAAGCCACTGATGAAGATGTGCAATTGGTTAGAGAAGCCATATAAAGAGCG
AAGGACTCAAAGTCTGGTTAAGTCTAATGA


>Contig17998.0.g14(protein)
MTSSNNKPPLLQRNSYFDNAKNFDSDEKDQKEEQIQAKQLLNNFTNAALTTPQSAQKQRK
QNDFQIKNYAKKCGSSLISMDQNNMRSLSQTVKAYTDNQQEQHLQNVQIPTIKTCKNQSN
LWSTQTNFKNKLPIQISYQTHTDFRKNSVQEDEKQIQNINAGSQKNKNMNVSQKVMKYIE
ELENKKKQARDREQSEQKRKNDILVNARQEVQKRNYELIQLKKKRYKLLPETKIFIVVGS
YHTLRQALIERGWHENTDKSSTIFDLKFAIKMTDVCTQDLQDFQLVNHFFKNNLITTKTG
LCHSLKNLVWWNNVEIDAFFPKCFDLTDDMEIEDFKNEYRFIKAESILKTYVAQQSVNQI
EKLLLSIKICERRLKDIDDQLDDKTSVLIVSDIEWEYLQKEILTPEQQISLRSEKWFQLI
ENQFSDEFLQYQKNEDTQTSNLSQSTLEVQKRQFYLTYCTNILQRFQDKFPQNNINGRFN
TWIVKPGGKSRGRGIKVFRSYDKIMQYVKAVKGRSFIVQKYIENPLIVMKKKFDIRQWVL
VTDWNPLTVWIYKECYIRFSPIDYDITKLNDKFMHLTNNAIVSKSEKFYESEIEGNMWSC
EQFSSHLQETYQKDVFQDEIWPQIQKYVTCSLQSVQDMVENRKNSFEFLGYDFMVDEDLK
VWLIEVNSSPSMDLSTNVTERLVKLVLTDLPKVILDYPKAKKKKECDTGGFILCHKAKIQ
VDRPKDAMNLNLLSLQQVIKPAAKIEEDEDLDEFRQDDWGKEFKSGFQELEDDKYWMKQW
DKTEATDEDVQLVREAIQRAKDSKSGQVQ