Identifiers and Description

Gene Model Identifier

Contig17782.0.g92

Standard Name

None

Aliases

Contig17782_0_g92

Description

Transcription factor DP

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam08781 ) Transcription factor DP
  • ( pfam02319 ) E2F/DP family winged-helix DNA-binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001070000.00000000007999955850159168hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17782.0.g92(coding)
ATGCATTCTTATTCACCAACTAAGGAAAAAACTTTGATTGGCAAGAGGAACCTCAACTAG
CGTGACTTCACACCGCCAGATCCCTTGCAACCCAATGCATATGGGTAGAGTGATGACCAA
GATATGTTGGAGTTTTGCGGAAGAGATAACAACACAAATCAAATAAGAAGTACAGTTGCT
TCTGTTAGCCAGACCATTTCAGCAAACTAAACGCAATATTAATAACAGCAAAACTAGCCT
CCAAGATTCCCACCATAACAACATCCTCAATATTCAAGACTTCCCTAAAACTACAATCAA
GAAGATGAGGGAGTAATTGAGACGATTTATGATTCTATCTAGAGTGATTCGGATGAAGAG
ATGAAAATGCACCAAGACATCACAGATTTTGACGATGGCAACAGCACTGCGAATTTCAAT
GGAAACTCCTCTAATAACGCGAATCAACAGCAAAATAAATACTACAAATACAATAGGAAA
AAACGATCATCCGAAAACAAAAAGCTAGTTTTTCTGTCAAAAAAAGTATTGGAGGAAGTT
TCCACGAAACACGAAACAACAGGCACAAATATTGCTAATCATATCCTTGAAATTTACAAA
GAGCGTAACATGAAACTTGATTTTAAGAATGTGCAAAGAAGAGTGTACGACGCACTGAAT
GTTTTGAGTGCCCTTGACGTGATTACTAAAGATCGAAATAAAATTACCTTTAAAGGATAT
AATGGAATACTTTAACATAGTCCTCGTGATTCAAATGGTCTTCAAAATGGAAGCGATCTT
CAATTTTAAGAGAGTGCTAGATTGTACAATAATCAGGTAGATTGTAGTAATATTTTGATC
ATAACTCATGAATTCATAATTAAGGCCAAAATTGAGATTGAAGAAGCTAAGAATAGATTG
CAATAAAAAACAGCTCATTTCCTTGAATTAGCATAACAGTCGATAGCTCTTAAAAAACTG
GTTGCAAGAAACTACATGATGTATCATAGCAGGGAAAACTAATCTGCTCCGGAGAAAAAG
ATTGATATTCCTTTCGTTGTTTTGAAACTTTAGAAAAACGCTCAAGTGGAACTTTAATAG
AAGGATGATCAAACTTAGTTGATACTGTAAACTGATAGGGAATTGGAAATGTTCAATGAG
AATCACATTTTGTAGAAATTGCAATTGAACAAAATCACCAAAGATGACATCAAGAATCTG
TTACCAACTCACATTTAATAGCATCTGCATGAGAGATATAATGTTGAAGATGAGTAACTC
ATCGAAAACTAGTTGTATTGCGACGAAGCCCCTCTTACAAGTTCTGAAATCATACACTCA
TAGCAAAGTCAAAACGCTGAAATAGAGTACCAGAGTCAACCAAACTATGACAATAACATA
TTCTCGTAACATTCATACTATGATAGTAGAGGACATTAAAATAACCATCATTAGCCACAT
ATCAGAAAATAGAGTGATTTTGGCGGCAATCAAATCAACTTGATATCCAATCCAAACTCC
ATTTAAAATACTCCCATGAAGCAGAGGTATAATTAATACTCTCAGGTTAGTTAGTATGGC
CAGGCTTTGAGTTTTGGAACCTTGAGAGGCAATTAGTTCAATTTGACATCGCCATATAGG
CACGTCAGTAAGAATGAATCCATCGATATTCACAATAGTTTTATGGATAAGAATGATCAA
TATAACTATTTGAGCTCTCCATTTTACGGATCAAGTAACATCATTATGGGAAATGATGTG
TTCAATGAGATGGAATCTACAAACTACTATTCTAACTTTACAAATATACCACAGTCAAGA
GATAAAGTTCAGACAAAGCAAGGTATATAGACAAAGAGTCCAATAAACGTGAATAACTAC
ATGTAGAACCCAAATTCATAATCAAGCAACAATGAAAATTTGAACAACAGAGATACTCCC
CTATTAAATAATTAAACAAAGTATCTAGGAGGTAAAGTAAGCCCTCTAGGTGTACCTTCG
CTTTCCAATATACTTTAGCAATGA


>Contig17782.0.g92(protein)
MHSYSPTKEKTLIGKRNLNQRDFTPPDPLQPNAYGQSDDQDMLEFCGRDNNTNQIRSTVA
SVSQTISANQTQYQQQQNQPPRFPPQQHPQYSRLPQNYNQEDEGVIETIYDSIQSDSDEE
MKMHQDITDFDDGNSTANFNGNSSNNANQQQNKYYKYNRKKRSSENKKLVFLSKKVLEEV
STKHETTGTNIANHILEIYKERNMKLDFKNVQRRVYDALNVLSALDVITKDRNKITFKGY
NGILQHSPRDSNGLQNGSDLQFQESARLYNNQVDCSNILIITHEFIIKAKIEIEEAKNRL
QQKTAHFLELAQQSIALKKLVARNYMMYHSRENQSAPEKKIDIPFVVLKLQKNAQVELQQ
KDDQTQLILQTDRELEMFNENHILQKLQLNKITKDDIKNLLPTHIQQHLHERYNVEDEQL
IENQLYCDEAPLTSSEIIHSQQSQNAEIEYQSQPNYDNNIFSQHSYYDSRGHQNNHHQPH
IRKQSDFGGNQINLISNPNSIQNTPMKQRYNQYSQVSQYGQALSFGTLRGNQFNLTSPYR
HVSKNESIDIHNSFMDKNDQYNYLSSPFYGSSNIIMGNDVFNEMESTNYYSNFTNIPQSR
DKVQTKQGIQTKSPINVNNYMQNPNSQSSNNENLNNRDTPLLNNQTKYLGGKVSPLGVPS
LSNILQQ