Identifiers and Description

Gene Model Identifier

Contig1778.0.g6

Standard Name

None

Aliases

Contig1778_0_g6

Description

Proteasome subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603
  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001582101.9999590304423412e-72Proteasome A-type and B-type f
amily protein
SGDYMR314W8.000631584680795e-59PRE5 SGDID:S000004931, Chr XII
I from 901709-902413, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1778.0.g6(coding)
ATGCTTTCAGTCAATTACAGCTTGAACTGTGTCACTTTCGATCCCAAAGGAAAGATTTTA
CAAATTGAGTATGCAAAGGAAGCAGTGAAACAAGGATCAACCTCCCTCGGTCTAAAATCA
GACAACTTTGTGGTACTTGTATCATTGAAAAAGAGTCCACATGATTTGGCCAGTCATCAA
GAGAAGGTCTTCGATATCGATGATCACATGGGTATTGCAATTGCAGGTTTGACAGCTGAT
GCCAGATATCTATGCAAATTCATGAGAAGCGAATGCTTGAACTACTGGTACACTCATGAC
AGTCACCACCCAACAGAGAGACTTATCAATAAAATTGCAAAGAAATCTCAAATTAAGACC
AATCACCCAGCCAAGAGACCATTCGGAGTAGGTTTATTGGTAGGTTCAGTTGATGAGACA
GGCACTCACTTGTTTGAGACCTGCCCTTCAGGCAACTACTACGAATATATCGCTATGGCC
ATTGGGTCTAGAAATCAATCAGCCAAAACCTACCTTGAGAAGAACTATCAAAGCTTCAGC
AGACTCGGATGGGAAGAGCTTGCTAAGCATGGTCTCAGAGCTTTGAAGGCCTCAGCTCAA
GAGACTGAACTCTCTGAACATAACGTGAGTGTTGGAATTGTTGGCAAAGATCAGAAATTC
AGACTCTTAAACAACGATGAGCTTAGAAGTTACCTTGCAGAAATCAGTGATTCAATGGAG
ATCGCATGA


>Contig1778.0.g6(protein)
MLSVNYSLNCVTFDPKGKILQIEYAKEAVKQGSTSLGLKSDNFVVLVSLKKSPHDLASHQ
EKVFDIDDHMGIAIAGLTADARYLCKFMRSECLNYWYTHDSHHPTERLINKIAKKSQIKT
NHPAKRPFGVGLLVGSVDETGTHLFETCPSGNYYEYIAMAIGSRNQSAKTYLEKNYQSFS
RLGWEELAKHGLRALKASAQETELSEHNVSVGIVGKDQKFRLLNNDELRSYLAEISDSME
IA