Identifiers and Description

Gene Model Identifier

Contig17686.0.g39

Standard Name

None

Aliases

Contig17686_0_g39

Description

PPPDE putative peptidase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006640307.000176714425793e-58Thioredoxin family protein
SGDYCR083W0.000004000864880866421TRX3 SGDID:S000000679, Chr III
from 259578-259961, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17686.0.g39(coding)
ATGGCTGCCTAATTCTCAAGGCAATTGATCGGCAAGCACATTGAGGGAGTATGGCATACA
GGACTTGTTGTGTATGGTAAAGAGTATTACTTTGGAGGAGGTATATCTTATGATGCTCCA
GGAATGACTCCTTTTGGGAGACCAACGAAAGTTATGGATCTTGGCTTCACTGAAATTCCT
GAGGATATATTCATGGAATTCTTAAGGGAGGTTAGTCCCAGATTCACACAAAATACCTAT
CATGTACTGAAACATAATTGCAATAACTTCACAAATGAGTGTGCTCAGTTTTTAATGGGA
GAAGGAATTCCACATGATATCGTTGATTTGCCCAATCAATTTCTGAATACTCCTTTTGGA
TCTATGGTTTCTCCTATGTTAGAATAAATGCAAGATAACCTCAAAGTCAATAGTCATCAA
CTTTTTGATGATGGAGGCCATTAAAATCCATTAGTAACAGGTAGTAGTCCAAGCGCTTAA
TAATTGTCAGGCTTAGGTCAATAATAAAATCCAAATATGAATGATATGAATGGTTTTATC
AATTAATTTGCTGCAGGCATGGGAGGATTAGGATCAAATTCAATGAATCCTGCTTTTTCA
TAACCAGTTTAACAGCAACTATAATCTCAACAGACTCATGGAGTTGCAATTTAGATCCAA
AACTTACAACAACTCTAAAAGCTTATTAAAGAAAGTCCAGCAATTGCAATCGATTTCTGG
AGCCCTACTTGCCCACCCTGCATAAAGATAAAGCCAGTATTCGAAGGATTAGCTAAAGCA
AATGAGAACGAAAATCTAAAATTTGCAACAGTAAATACATAAACCTGTAGAGACTGTGCT
ATGGCTTTTAAGATTACCAGTATCCCATAATTCTACTTTTATGTCAATGGAAGTGAACAC
AGTTAATTCAAGGGAGCCAGATAAGATCAATTAACAGCAACTCTGGTTGAGTTAGATGAA
TTAGTAAAGAGTAAGTCATCTTAACATAAGAACATGAACTTTAAATAGTTCAAGCCTATG
AATCTTGCTCCTCAAGGATTTACTGGAATGGCAAATCTTGAAAAGATGAAAGAATTTGTT
TCAAACTTTGCTAAGTCAGAAGAAGTTTAAAAAGAGGTAGCCTCAACTCAAAATTTGTAA
AAGTGGTTAGTAGGCTTTAATTTAGAAAATATGCCAAGAGAGGCAATTGATGAATTAGTT
TCAATGATTGAAATAGCTGAAGATAAATTCAAAATTGCTTTGATTGACTTGCTAAGATTA
TTGATGGTATATGAACATACTGCAGCTCATATTCTTAATAAGCACTGGCAGACTATCGAA
GTAACTATCTTTGGTTATCTAGAATGCATGGATTTGAAAGATCCAGAAGCAAAAGTAACA
TAAAACTATCATTTAATAAGCTTGAAAATGCTTGGAAATATTTATCAAACAAGTTAAGGA
AAAGATTTCATGCATGGAGAGGATGCAAGCTAAAGTTTAATAAATTTCTGCACTTATAGT
TTTTCATCAATCAACCCTAAAATAGTATTTACAGCAGCTATAGTACTATTTAACCATATT
TTATGTTGGAAGAGAGAAAAGAGCATCTTGTTCCTCGAACTAGAAAAATCCATTCTAAAA
ATCAATGAGATACTTGCTGATCAATCATTGACTGATTTTGAGGCAGTTATAGGTCTACTG
CTTTGTGAGTGCAGAATGCTTTATCAAAACAAATTATTATGTGAGAAGATAGCTGATAAG
TATGAATCAGAATTCAAGAAAAATCATTAAGCATTAGAGCTGAGAGTTAAGAATCAGAAG
GTCAGAGAAGCAATTGATGATGTTTTTATGATGTTATTTGATTGA


>Contig17686.0.g39(protein)
MAAQFSRQLIGKHIEGVWHTGLVVYGKEYYFGGGISYDAPGMTPFGRPTKVMDLGFTEIP
EDIFMEFLREVSPRFTQNTYHVLKHNCNNFTNECAQFLMGEGIPHDIVDLPNQFLNTPFG
SMVSPMLEQMQDNLKVNSHQLFDDGGHQNPLVTGSSPSAQQLSGLGQQQNPNMNDMNGFI
NQFAAGMGGLGSNSMNPAFSQPVQQQLQSQQTHGVAIQIQNLQQLQKLIKESPAIAIDFW
SPTCPPCIKIKPVFEGLAKANENENLKFATVNTQTCRDCAMAFKITSIPQFYFYVNGSEH
SQFKGARQDQLTATLVELDELVKSKSSQHKNMNFKQFKPMNLAPQGFTGMANLEKMKEFV
SNFAKSEEVQKEVASTQNLQKWLVGFNLENMPREAIDELVSMIEIAEDKFKIALIDLLRL
LMVYEHTAAHILNKHWQTIEVTIFGYLECMDLKDPEAKVTQNYHLISLKMLGNIYQTSQG
KDFMHGEDASQSLINFCTYSFSSINPKIVFTAAIVLFNHILCWKREKSILFLELEKSILK
INEILADQSLTDFEAVIGLLLCECRMLYQNKLLCEKIADKYESEFKKNHQALELRVKNQK
VREAIDDVFMMLFD