Identifiers and Description

Gene Model Identifier

Contig17503.0.g2

Standard Name

None

Aliases

Contig17503_0_g2

Description

Partial alpha/beta-hydrolase lipase region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam04083 ) Partial alpha/beta-hydrolase lipase region
  • ( pfam00561 ) alpha/beta hydrolase fold
  • ( pfam12695 ) Alpha/beta hydrolase family
  • ( pfam12697 ) Alpha/beta hydrolase family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007230902.0002571866765887e-62ab-hydrolase associated lipase
region family ...
SGDYKL140W9.999888128184441e-42TGL1 SGDID:S000001623, Chr XI
from 180779-182425, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17503.0.g2(coding)
ATGCAACTACCTCCTATGAACAGTATCATTGGGATACTGACAAATTTCATGATTTACTGG
ACTTTCCATCCATCATATCGTCAATAGATGTATGATGCTGGCACCGCTCTCTATACTGCT
CTTGAATAAGATGTGTTCCAGCCAGGTTTTAACTACCCAGTTGGATATAATATGACCATT
TAAGAGTAAGTGGAGTTCCATGGATATAATTTTGAAGAACACAAAATCCAAACCGAAGAT
GGCTACATTCTTACTGCTTTCAGAGTCCCCTCAAAGAAAGGAGAGAAAATCGGCAATCAA
AAGACCCCAATCTTCATGCAACACGGTCTCATTGACGATGGAGGTACTTGGTTCTACAAT
AATGAGACTCTTGATCTCTCTTTGGAATTGGTAGATCTTGGCTATGATATCTGGGTCACA
AATTCTAGAGGTACTGTGTATTCTAATGAACACGTAAACCTTACAGTTAACGACAAGGAA
TACTGGGACTTCACTTATCATGAAATGGGAAAGTATGATGTTCCAGCCAACCTAAAGTAC
ATCTTCAATGTTACTGGAGCTAATCAAGTTGTTTACTTCGGTCACTCTTAAGGTACTACT
TAATGGTTTATTGCAAATGCTTTGAACCCAGAAATCAGTTAATACTTCAAAGCTTTCATT
GGAATCGCTCCTGTAGCTCATGTTACCAACGAAAAGAGTGTTATGGTAAAGACTCTTGAC
TTGCTTGAGATCCCAGATCTTGCTTACGAGTATCTTTGGGACCTTGGCTACATCCCAGCT
GTCTCAACTTATGCCGCCCCATTCCTTCACTACTTCCCAAGATTTGTATGGAATTTCATT
GAGACAGTAGTTGGTTTCGACAAGACATATCACATCGATCTCGGTTCCCTTCCAATGATG
GGAAGAAACGACGTTGGAGGCACCTCAACCAAAGACTTATTGCACTGGACCCAAAACATT
AGAAGTGGCAACTTTGCTGAGTTCGATTATGGCTCTGATATGAACAAACAAGTTTATAAC
TCAAGCTACCCACCCAACTACAACATCGATCAATTTAAGACTACTCTCGCTCATGTTGAA
GTATTGTTGTTCTGTGGTCAAAATGATGCATTAGTTGCTCCTGATGATCTTAAGATCTTG
CAAAATGCTCTACCAGTTAACACCCAAACTATTTCAGTTGAAGACTACAACCATCTTGAT
TACATGTGGGCAGCTGATGTCAATGAGAAGGTTAACAAATACGTTATCGATTTTCTTACT
CACCTTTAAACTAAGAAACCAATTATGGAATGA


>Contig17503.0.g2(protein)
MQLPPMNSIIGILTNFMIYWTFHPSYRQQMYDAGTALYTALEQDVFQPGFNYPVGYNMTI
QEQVEFHGYNFEEHKIQTEDGYILTAFRVPSKKGEKIGNQKTPIFMQHGLIDDGGTWFYN
NETLDLSLELVDLGYDIWVTNSRGTVYSNEHVNLTVNDKEYWDFTYHEMGKYDVPANLKY
IFNVTGANQVVYFGHSQGTTQWFIANALNPEISQYFKAFIGIAPVAHVTNEKSVMVKTLD
LLEIPDLAYEYLWDLGYIPAVSTYAAPFLHYFPRFVWNFIETVVGFDKTYHIDLGSLPMM
GRNDVGGTSTKDLLHWTQNIRSGNFAEFDYGSDMNKQVYNSSYPPNYNIDQFKTTLAHVE
VLLFCGQNDALVAPDDLKILQNALPVNTQTISVEDYNHLDYMWAADVNEKVNKYVIDFLT
HLQTKKPIME