Identifiers and Description

Gene Model Identifier

Contig17485.0.g101

Standard Name

LIG4

Aliases

Contig17485_0_g101

Description

ATP dependent DNA ligase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003870501.0001043265246556e-154DNA ligase IV
SGDYOR005C2.0008958828286524e-54DNL4 SGDID:S000005531, Chr XV
from 337343-334509, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17485.0.g101(coding)
ATGCAAGAATCAAAAACTCGCACCAATAAATCAGGCTCAAATGAAGTAGTGAGTTTTTAT
GAAAAACGCAAGTCAGATGACTAAAAAACTGATGTTAAATTGAGTTCATTTATATAATTA
CTTGATCGGTTGGGTTAATCCCAGAAAACTCAATAAAAATTGCTATTGATAGAGAAATTT
ATAGAGCAATTCTATTCAGCTCATGATCACAGACAAATATTTCAGTTTATGCGGCTTTTG
ATGTCAAATTTAGATAGAGAAAGAGGCAATTATGGATTAAAAGAATCAGCACTTGCTAAG
TTTTACTCAGAAATTTTGCTCTTACCTCCTGCAGAGGCTGACAGATTGAAACATTGGAAG
AATCCAACTAAGTAACCCATAGGATCCCCAGCTGGAGACTTTGTAGGAGTTTTGGTTCAT
GTGATGAAGAATAGAGCGAGAAATGACTCAAAACTGACATTAAATTAACTAAATTAATTG
CTAGATTAATTGGCCAGGTCTTTTGATAATGAAAAAAAGAAGCAGATTTTAGCTAGAATT
GTATAAGATACGACAATAGATGAACAGAAATGGATTGCTAGAATCATCTTGAAAGATTTA
AAGATAGGTATAGGTTATGAGACAATCCTCAAAAGTTACCATCCAGACGCCTTAGAGCTT
TTTAATGCAACAAGTGATTTGAGGTCAGTATTTGAAGAGCTTTAAGTTTAAGAAGACTAA
GTCAGACAAGGTTCAGGAGGGAATCAATAAATGTTTAGAATGTTTTTCCCAATTAAACCT
ATGCTTGCTGGAAAACTAGCTCCATAGTAAATTGCTGAGATGGTAAGAAAAGAAGGGAAA
GTCTTGATCGAAAACAAATTTGATGGGGAGCGAATACAGTGTCATATGCAGGATGGAGTG
GTCAAGTTTTTCACAAGAAATTCGAATAATTACACAAGGATATATGGACCTGGAATGAGC
AAATACATCAAAGAAAACGTTGATGCTTAGGCTGTCATTCTAGATGGTGAGATGATTGTT
TGGGATAACTAGAAAAACTAGGTTGCACCTTTTGGTCAGAATAAGCAAGTAGCTCTCAGG
GAGTATGGAGTCTATGAAAATGCGCCACCAGAAAAGCCTTTCAAAGTTAAGTAATAACAT
TAACAGGATGGGGACAATTAAAGCGAAACTACCAAGAGTTAATCTGCAGCTGATGGTTCT
CATCTGTAACTCTGCTATAAGGTATTCGATATCTTGTATATAAAAGCTCATGGCGATAGC
GAGGAAATAAATTTAATGGGAGCTAGACTTCAAGACAGAAAAACTGTACTCTCTAGAATT
ATAAAAGAAGTTCCAAATACTCTTGAAATAGAAATGGGAAAAGAATGTGAGACGGTTGAC
TAAGTGTTTGATGAGTTCAATTAAAGCATTTACAAGAATGAAGAGGGAATTATTATCAAG
AAAATTGAATCTGTTTATAAACCAAATGAGAGGTCAGTTAACTGGATTAAACTTAAGGGA
GAATACATTGACAGTTTAGGTGATACTTTAGATTTGATAGTTATCGGTGGATACTTTGGC
GAAAGAAAAAGAATAGGAGGCAATGATTGGACAGATCATATTAATGTATTTCTTGTGGGT
GTAATGAAGAAGTTGGATAAATAGAATCCCTAAAACTGTGTAGTATATCCGTTTTCAAGA
GTAGGTACAGGTTATTCTATGGATGAACTTTCAAAGCTAAGAAATTAGCTTAAACCCTAT
TGGAAAATGTATGATGCCAGAATGCCTCCCGCTCTTTATGGTCGTTGGGTGCCTTCTATG
TCAGATAGACCCGATGTTTACATCACAGATGTCTCTAAATCTGTGATTCTTGAAATCAGA
GCTGGTGAGCTAGTCGTCTCTGATTAATACCCGACCATGTATACCTTGAGATTTCCAAGA
GTCCTGAAGATTAGATATGATAAAAACTGGGATGAAGCTTTCAGTCATTATGATCTTTAG
GATATGATTAAGAACTTCTAAGAATCTCGTAGACTTAAGAAGAAGGATAACGCAAAGGGT
ATTTATGAGCACAACGATGAAGATGAGGACGAATAATAAGACGGAAAGAAAAAGCGAAAA
AATAAGAAAAGAGCTATTTCAGAGGAAGAACTGAAAAGCAGGGATGGTTAAGCTTCAGAA
GATGGTTAAATTTATATCACTCATAAGGATAAATTCAGCAAGGTTATTGATTTTTACAGA
GAAGCAGATACTAAGAATGTTGTGAGAAAGTCTGATATGTTTAGAGGTATGGAGTTCTAC
ATTGTAAACGTCGATGATTCAATTGCTAACAAGCCCTATCTTGAAAGTAGAATAGTTGAG
CATGGTGGAACTAGAGTGTAAAACCTCAGACCCACAACTACTCATATAGTAGCGGCACAT
ATCGACTTCAAAGTAAAGATTCTTATTGAGAAATTGAATATGAACATAGTTAAGTTTAAT
TGGGTCTTGGCTTGTATTGAAAGAGGGTTCTTAGTTGATTTAGAACCTGTGTACATGCTG
CACGCTAATGAGAAGCTATTAGAGTATTTTAGAGATAATCTAGACCCTTATAACGATCAT
TACACTCAATTTGTTGATCCAAAACGGCTGACCGAAATCCTTGATTAAATCCCTAATGAT
AAAATTGAGTTTTAAATAATCGATACAGACCCAGATATCGAATAAATCTTCACTCAGGTA
GGATGCAGAGGTCTCTTCTATGGTAAAAAGTTTTATTTAATTCGATCTGAGGGGGTTTTG
GAACAAATGACAACCTAATTTGACATGGAAATCGAGTACTAAAGTTTGTTACATGCTAAA
TTTGCTGGATACTATAGGAAATAGCATTTGCAGTTATCCGAGTAGAAAAGTGGGAAAGAT
GTTAAACATAAAAATCTCATGTTTAACAAGTTATAAAATGAAGAAGATTAAGTAGTAGTA
AAATGTGTTGATAAAATTATGAAGATGGAAGAGTTCAATGTTTTAAGTAAGCTTCGATTA
TATGGAGCAATCCTCTTAGATTCATTGCCATCATCTCAGCACTTAACACAAGATCATGTT
GATTATATAATCTTGACTGATAGAGTGGGCGATAAGGAAGATATTTAGAAAATAAAGTAA
GTCGCCTAGCGTAGAGGATTATAAGTTGTTGATATCAAATGGCTTGCTGATAAAATGAAA
CAATTCGAAGATAAAATTATTAATGATGAAGCTGATGATAACGATATAAATAATCATGAT
GAAAAGATTATATAAGATAAAGAACAGTCCAAAAGTAGTGATAAAATAGGAGATTTTAAG
CTAAAAGATAAAGATTAAAGTGAGAAAAAACCTGTAAATAAAAAAAGTGTAGATAAGAGA
AAGAGAGATAGTGATGATGAAATAATGAGGGCTCTTGATAGATTTAATGAAGATATATCA
ATGAGTCTGAGTTGA


>Contig17485.0.g101(protein)
MQESKTRTNKSGSNEVVSFYEKRKSDDQKTDVKLSSFIQLLDRLGQSQKTQQKLLLIEKF
IEQFYSAHDHRQIFQFMRLLMSNLDRERGNYGLKESALAKFYSEILLLPPAEADRLKHWK
NPTKQPIGSPAGDFVGVLVHVMKNRARNDSKLTLNQLNQLLDQLARSFDNEKKKQILARI
VQDTTIDEQKWIARIILKDLKIGIGYETILKSYHPDALELFNATSDLRSVFEELQVQEDQ
VRQGSGGNQQMFRMFFPIKPMLAGKLAPQQIAEMVRKEGKVLIENKFDGERIQCHMQDGV
VKFFTRNSNNYTRIYGPGMSKYIKENVDAQAVILDGEMIVWDNQKNQVAPFGQNKQVALR
EYGVYENAPPEKPFKVKQQHQQDGDNQSETTKSQSAADGSHLQLCYKVFDILYIKAHGDS
EEINLMGARLQDRKTVLSRIIKEVPNTLEIEMGKECETVDQVFDEFNQSIYKNEEGIIIK
KIESVYKPNERSVNWIKLKGEYIDSLGDTLDLIVIGGYFGERKRIGGNDWTDHINVFLVG
VMKKLDKQNPQNCVVYPFSRVGTGYSMDELSKLRNQLKPYWKMYDARMPPALYGRWVPSM
SDRPDVYITDVSKSVILEIRAGELVVSDQYPTMYTLRFPRVLKIRYDKNWDEAFSHYDLQ
DMIKNFQESRRLKKKDNAKGIYEHNDEDEDEQQDGKKKRKNKKRAISEEELKSRDGQASE
DGQIYITHKDKFSKVIDFYREADTKNVVRKSDMFRGMEFYIVNVDDSIANKPYLESRIVE
HGGTRVQNLRPTTTHIVAAHIDFKVKILIEKLNMNIVKFNWVLACIERGFLVDLEPVYML
HANEKLLEYFRDNLDPYNDHYTQFVDPKRLTEILDQIPNDKIEFQIIDTDPDIEQIFTQV
GCRGLFYGKKFYLIRSEGVLEQMTTQFDMEIEYQSLLHAKFAGYYRKQHLQLSEQKSGKD
VKHKNLMFNKLQNEEDQVVVKCVDKIMKMEEFNVLSKLRLYGAILLDSLPSSQHLTQDHV
DYIILTDRVGDKEDIQKIKQVAQRRGLQVVDIKWLADKMKQFEDKIINDEADDNDINNHD
EKIIQDKEQSKSSDKIGDFKLKDKDQSEKKPVNKKSVDKRKRDSDDEIMRALDRFNEDIS
MSLS