Identifiers and Description

Gene Model Identifier

Contig17452.0.g48

Standard Name

None

Aliases

Contig17452_0_g48

Description

Sec7 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004020396.00073507697681e-75hypothetical protein
SGDYDR170C9.99967697349061e-30SEC7 SGDID:S000002577, Chr IV
from 802222-796193, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17452.0.g48(coding)
ATGAAAAAACTTACTCACTAGAGCAATATAATACAAAGTCAAGCAGATGGGATCGATGCG
ATGACGGCATATCATTAGGAGACAGATTACATCGGGGCGCCCAATTTCGCAAGCATACCA
GGATTGCACAAGAAAACAGAAGACTAATTAAAAACTGTAAACTTAGAGGGTCCAGAATAG
GAAGATAGAAACAGTAACTAACTTATATATTCCTCATAAGAAAAATTGATAAGGAAAAAG
GATGATGCAAAATTGGAAACTAATTAAGTTTAAATATAAGAAAATGTTTTTGGACGCAAA
AGTGATATTACCAGTTCATCAGCCTTAAATTAAGAGGAAGAGATCGTATTTGTAGATTAA
GTAAAACTAGCATAAATGCGTGGAAAATTTAATGCTTAGCTAGAGAGAAACTAAATCAGA
CTAGGACATGAAGAGATAAAGCATCATTACCCCTAATCAAATAAAAACCTCAATGACCCA
CAAAACAATTAATGGTAAAAGGATTTTTATCATTTCAGGGATTAGTTAGAAGTCAATAAT
AACTCCATGGATGAACAAGGCTCATCAGCACGATTTGAAGATATTATATAGCCTTAATAA
GACTATCTTAATGCCAGAAACAATATTAAAAATAAAGATGAAGGCTTTAAATTTTAGGAG
TCTGGTAGTAGTGGGAATGAAGATAGGAAAACCTTATAAAATTCAAATCAAGCTTCAATA
AGAACTGACAGTGGATACTACTAGGAAAAAGATAATTCTTCAAGCTAGTACGACAGCCCC
ATCCCAACTAATTTCCAAGGTTTTCATCAAATGTAAGAAATGAAAAGTATCTTGACATTA
AATCAAATAAATTGTGAACTTAAAAGCCACTTGAGAAGATTCGATGAGATTATAACTTAG
AATCAAGAATCCATTCAAAAACATTTATCTCTACAGCAGCCATAAACACAGTATTCTATG
ACTTCGAATGATGTGATGTAAAGAATGGGAAGCAAGTAAGACTTAAATTAAACACCTAAA
TTCATATCATAAACTTAAGTTTTAAGAATGCCATCTCAGTAAGAAAGAAAATCTTCTAGT
TATTATTCAATCTCTCAGCATTCCTCTTTCCAAAAGGTCAATATTGTGTCTCCTAGTAAG
GGAGCATCCAGTAAATTTGTCAGCGATTTTCATATCAGAAAAAGTACTGAACAAAGAATG
GATGAAATGCTTTTACAACATAGATCATCCTCAGGCCTTTAAACCAATTAACAACATAGA
TTTAATAAGCAATTCTTTGAAGATTTAAAGAAATAATAGATTGGCTTTGCTACTATTCTT
TAAGAAAGAAAACCTTTTGAAACAGGACAGAGTAAAGAAGACATTTAATTCTAGGGTTTA
GGCACGTAGACTAATTAAAATGCCAAGCTATTGTTAGACTCTTAAAAATGGGCTACTGGT
TAACATAATATATTTGGAGATGAATGGAATGTTAAGAAGAAAAACTCTAAATTTCTTGAA
AACCTTCATACCAAAATCGAACAAAATAACTAACTTAAGTAAAGCGTTGAGCGTGCAATT
ATACTATTCAATGAAAAACCAAAGAAAGGAATCGACTTTCTAGTAAAGCAGAAGTTTATT
GATTATGATGCTTAAATTATAGCAGAATTTTTACTCACAACTCCAGGATTGAGTAAATAT
GCGATAGGCTAATATATTGGTTTGAATGATCCATTCTCAAAAGAGGTTCTAAAAGAATTC
AGCAATAAATTAGACTTTAGAGAACTAGAAGTTGACGAAGCTCTCAGATTTTTCCTACAG
TAGTTTAGACTGCCAGGAGAAAGTTAACAGATTGATAGGATCATTGAACAGTTTTCTAAT
ACTTACTACCTTGACAACGCATACAGCTTCAGAAATGTAGATGGAGTTTATGTGATGGCT
TATTCATTGATTTTCTTGAATACATTGAACCACAATTAAAATGTTGCAGCAAGCAGAAAA
TTAACTAAGTAGATGTTCATATAACAAAATAAGATAGAGAATCCAAACTTCCCTGATTCA
AAACTTGAAGAAATGTTTGATAGAATTATGCAAAACTAATTCAAAACTGATACTTTATTT
GTCGAAAAGATTTATGAAAGAATCAGAGCATTTAATCATGAAGAGACAACTAAAGAGACT
ATCAAATTATCAACAAATGTTCTTTAATAAGGTGAACAATTCTTAAAATTTGGAAGAATG
GGAAAACCTCATTTGAGATTTGTCTATGTTTCTGATGATGAGCAAAATCTATTTTGGTGT
ATTTAAAGATAAGGCAATAGAAAATCTAGAATAAAGTGTATTAGATGCGATGATATTGTA
GATATTAGAGTTGGTTATAACTCTTCGAAAATCTTAGTCAAACATTAGATACCAATTGAG
TTTGATGACTTGATTTTTTCGATAGTCACAAATAAAAGGACACTTGACTTGCAGGCTAAG
GATTCTGAGATAAGAAATAGATGGGTTAAGTTCTTAAAAATCATACTTAATGAAAACTTA
AGCAAGCTAAAAGTAAAAGATGTCTCTCAAAACATAGAAGCTTACGAACGAAGGCAAAGA
ATTTAACATGATCTAGAAGAAATATGGGAAAATGACATTATGACTAATTTTGCAGAGCAT
TGGGATTACTAAAATCATTGTCCTAAAAAGTAATCCAAGTAAGGAAAAATTCAAAGCTAG
GCAAAGTAATCTGGATCTAAAAAGAAGAGAAGCTGGATATGTAAAATCAATCCTAAGAAT
TGTTGGAATGAGCATAATAGGAGAATTCTAAAGAATGAAAAGAAGGGAAATCATTAAGGT
CATCTATCAAACCGCACTTCAGACTACAGCCCAGAGAGAGATTTTGACTTTGATAGTTAA
AGTTAAGGATTCTTTTTAGAAAGCTTATGGAGGAGAGGTATTCCACCAAAGTTTAGAAAG
AAGATCTGGCCTTTCGCGATCTAAAATAAACTTGAAATCTCAAAGCAACTGTATAGAATG
AATCTTAAAGAAGGTCTAAGCATCGTAAACAGTATCCAGAAATCCTTGAGAACTTAAAAG
AAGGGGCTTTAAAAACAGATAATTGAAAAAATTGACTAAGATATTAAAAACACTCTCTAG
ACTTTCAAAATATACTTCATGAGAGAAAGTAACCTAAGTAACAAATGCACTATCAAGCAT
AAAGAATATGGATAAGAGGAATTCAAAGAAATCTTTGAAATAGCAAATAGTATTGATAGA
TCTAAGCTTCACTAAGATGACCATTTCCAGTTTTCTGACAGATCAAATACTCCATAAGAT
CATTTGAAAATAGATGATCTAGAGATAAAGCGTTAAATTGAGATTATAACTCCTGGTACA
GCCTCTAGAGATCCATGTATGAATTAAAGCCTCAACGAAGCCCCTCCAAGAATCCCTTTA
ACAAGCAACAATAACACTTTCCTTCAAAATTAGTCAAATGGAACAGTAAGCGGAGCTCAA
TACAATTTGAGATATGAATCACTATTCAACAACATCATCGCTTTCATTATGCAGAGGCCA
GACATTGGCTACTTACCAAATGTCAGTTATTTAGCTGGAATGTTTTTGATTTATTGCAAT
GAATATGATTCATATGCTGCTTTCACTAACTTTATTCACTCGCACTACTTCTTGGATTTG
TTCAAAGGTTAACTTTCTGATATTAAACTGAGAATAAACTAATTCAACAAGCATTTCTAG
AAGTTAATGCCAGATCTATTCAGGCATTTTGAGACTCTTGATATCACCACAGACTTATTC
CTCATAGACTGGATGCTAACACTTTACTCAAAGAATATGGACTTAGATATTGCGAGTAGG
ATCTGGGACAACTTTATGTTGGATGGTGAAATATTTGCAATAAAAACAGGCCTAGCCATA
CTATAATATCTTGAAAACTAATTGCTTAAGTAAAGTTACTTCCAAATAGTCAAGCAATTG
AAAAATTTACAAGGCAATATAATTGAGGAAGATAAGTTTTTTAGCTTAATTGAGCTTATC
AAAATAGATGAGTTAAATTATTATGCAGACATCAAGATGTAAAAATGGAGTTATTAAAAA
TCAAAAGTATTAGGCAGCGTTTTTATGTGA


>Contig17452.0.g48(protein)
MKKLTHQSNIIQSQADGIDAMTAYHQETDYIGAPNFASIPGLHKKTEDQLKTVNLEGPEQ
EDRNSNQLIYSSQEKLIRKKDDAKLETNQVQIQENVFGRKSDITSSSALNQEEEIVFVDQ
VKLAQMRGKFNAQLERNQIRLGHEEIKHHYPQSNKNLNDPQNNQWQKDFYHFRDQLEVNN
NSMDEQGSSARFEDIIQPQQDYLNARNNIKNKDEGFKFQESGSSGNEDRKTLQNSNQASI
RTDSGYYQEKDNSSSQYDSPIPTNFQGFHQMQEMKSILTLNQINCELKSHLRRFDEIITQ
NQESIQKHLSLQQPQTQYSMTSNDVMQRMGSKQDLNQTPKFISQTQVLRMPSQQERKSSS
YYSISQHSSFQKVNIVSPSKGASSKFVSDFHIRKSTEQRMDEMLLQHRSSSGLQTNQQHR
FNKQFFEDLKKQQIGFATILQERKPFETGQSKEDIQFQGLGTQTNQNAKLLLDSQKWATG
QHNIFGDEWNVKKKNSKFLENLHTKIEQNNQLKQSVERAIILFNEKPKKGIDFLVKQKFI
DYDAQIIAEFLLTTPGLSKYAIGQYIGLNDPFSKEVLKEFSNKLDFRELEVDEALRFFLQ
QFRLPGESQQIDRIIEQFSNTYYLDNAYSFRNVDGVYVMAYSLIFLNTLNHNQNVAASRK
LTKQMFIQQNKIENPNFPDSKLEEMFDRIMQNQFKTDTLFVEKIYERIRAFNHEETTKET
IKLSTNVLQQGEQFLKFGRMGKPHLRFVYVSDDEQNLFWCIQRQGNRKSRIKCIRCDDIV
DIRVGYNSSKILVKHQIPIEFDDLIFSIVTNKRTLDLQAKDSEIRNRWVKFLKIILNENL
SKLKVKDVSQNIEAYERRQRIQHDLEEIWENDIMTNFAEHWDYQNHCPKKQSKQGKIQSQ
AKQSGSKKKRSWICKINPKNCWNEHNRRILKNEKKGNHQGHLSNRTSDYSPERDFDFDSQ
SQGFFLESLWRRGIPPKFRKKIWPFAIQNKLEISKQLYRMNLKEGLSIVNSIQKSLRTQK
KGLQKQIIEKIDQDIKNTLQTFKIYFMRESNLSNKCTIKHKEYGQEEFKEIFEIANSIDR
SKLHQDDHFQFSDRSNTPQDHLKIDDLEIKRQIEIITPGTASRDPCMNQSLNEAPPRIPL
TSNNNTFLQNQSNGTVSGAQYNLRYESLFNNIIAFIMQRPDIGYLPNVSYLAGMFLIYCN
EYDSYAAFTNFIHSHYFLDLFKGQLSDIKLRINQFNKHFQKLMPDLFRHFETLDITTDLF
LIDWMLTLYSKNMDLDIASRIWDNFMLDGEIFAIKTGLAILQYLENQLLKQSYFQIVKQL
KNLQGNIIEEDKFFSLIELIKIDELNYYADIKMQKWSYQKSKVLGSVFM