Identifiers and Description

Gene Model Identifier

Contig17369.0.g57

Standard Name

None

Aliases

Contig17369_0_g57

Description

Transcription factor TFIIB repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004425905.999140071902665e-66Transcription factor TFIIB rep
eat family protein
SGDYGR246C9.99860868304602e-64BRF1 SGDID:S000003478, Chr VII
from 984272-982482, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17369.0.g57(coding)
ATGAAATGTAATAAATGTGGATCTACCTAGACTGAGTATAATGCACCTTAAGGCATTTAT
GCTTGTCTCGGTTGTGGTAATGTTTTAGAGAGCAATACCATTGTTTCTGAGCTACAATTT
GCAAACTCTATGGCAACTGGTTTCTTCCTCAATCAGAGGAATGGTCAAGCTGCTCTCTAC
TAAGGAAAGCGTGCATTATTTTCTGATTCAAGAGCCTTAAGACTTTCAAAGGGCTACAAA
GTTGTTGAGGGTATCGCCTCTTAGTTAGGTATGAGCTAATATATTGTTGAGGCTGGCTAG
AGATTCTTTAAACTAGCTTATGAGAAAAACTTCATTCAAGGCAGAAATACCAAGCATGTG
GCTGCAGTCTGCTTGTATATAGCTTGCAGGAAAGAGAAAACTCCCCATTTACTAATAGAT
TTCTCTGATGTACTTTAAACTAATGTCTATATTTTGGGTAGTGTTTATCTGAAGCTTGTT
TAAAGGCTATTCTTGGAAGTTCCCTTGATCGATCCTTCAATTTTCATTCACAGATTTTGC
TCTAAGCTGGAGTTTGAAGGTAAATCACATTAAGTTGCTCTCACAGCTCTGAGGCTTTTG
TAAACTATGAAGAGAGCCTGGATTACCACAGGTAGAAGACCTAATGGTCTTTGTGGAGCT
GCCATTCTTATTGCTGCAAGATATCACAACTACAAGAGAAATATTGGTTAGATAGTTAGA
GTCGTGCATGTCTGTGAGGAAACCATTAGAAAGCGTCTTGATGAATTTAAGAATACAAGA
ACTGCTCAATTAACTAGAGATGAATTCTAATCAATCGAGTAAGGTGGTAGACAGAGCAGC
AGTGCTACTAATACTAATGAGCAATATCAAAATGGTACAAATGGTTAACTTATGAACATT
GAAAAGTCACCAAGCAATCACAGTGTAGAGGAAAATATGGATCCTCCATCTTTCACCAGA
AACCTATGCAAAAAGAAACTTGAGATAACTGAAGACATGGATGAACTTCATAAAATGCTT
GAGGAAAAAGCATTCCAAATTGAAGAGAGGCTAATGAAATACGAAGGCCAAAGAAATTCA
TATTAAGAAGAGGTAAAATAGCCAATGACGCCACCAATCAACGATATGGACCTTTACTAA
TAGATTGATACTTCACAAAACATGCTTGTTCCTTACTAATTCAACTAGCCCTAGATTTAA
ATTCAAGACACAAATCGTTTGCAAATGGCTTTAAAATAGTTTGAATCAAACGATGGCGTA
GAAACACTCTCTGACATTGATGATGCCGAAATCGACTAATTAATTCTGACAGAGGAGGAG
CGTAAACTAAAAACCATCCTGTGGAATAATCTAAACAGAGATTGGATTCTTGAATAGTAA
GAGAAAAAGAGAATTAAGAGGGAAAAGAGAAAACTTAAAAACTAGTCTAAAAAGAAGACT
AAAGCAATTAAAAAACAATTGATCGTCAAGAATGCAACTAATCCAATCGATGCAATTAGA
AATAGCTCTAAGCTAGGTAACATTAACCCAAGAATTTTGGAATCAATTTTCAAGAGAGAT
CATTGA


>Contig17369.0.g57(protein)
MKCNKCGSTQTEYNAPQGIYACLGCGNVLESNTIVSELQFANSMATGFFLNQRNGQAALY
QGKRALFSDSRALRLSKGYKVVEGIASQLGMSQYIVEAGQRFFKLAYEKNFIQGRNTKHV
AAVCLYIACRKEKTPHLLIDFSDVLQTNVYILGSVYLKLVQRLFLEVPLIDPSIFIHRFC
SKLEFEGKSHQVALTALRLLQTMKRAWITTGRRPNGLCGAAILIAARYHNYKRNIGQIVR
VVHVCEETIRKRLDEFKNTRTAQLTRDEFQSIEQGGRQSSSATNTNEQYQNGTNGQLMNI
EKSPSNHSVEENMDPPSFTRNLCKKKLEITEDMDELHKMLEEKAFQIEERLMKYEGQRNS
YQEEVKQPMTPPINDMDLYQQIDTSQNMLVPYQFNQPQIQIQDTNRLQMALKQFESNDGV
ETLSDIDDAEIDQLILTEEERKLKTILWNNLNRDWILEQQEKKRIKREKRKLKNQSKKKT
KAIKKQLIVKNATNPIDAIRNSSKLGNINPRILESIFKRDH