Identifiers and Description

Gene Model Identifier

Contig17363.0.g63

Standard Name

None

Aliases

Contig17363_0_g63

Description

Reverse transcriptase-like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17363.0.g63(coding)
ATGAACCTTCAAAAACTAAGCTATTTGCGCAGTGCATTACAATAAAAACATCATTTCTCA
GCTTAATCTCTTTAATTTAAGCAGTTTTATATTGGTCAAAACATCGAAAGCAGCTTTAAA
TTCTTAAATATAAGCCAAAATAAACGAAATTTTTCTGCAAACTCTAATAATCCTAGTAAT
CCAATAAGCGCAGATAAACTTAAAGAAATCATCATGAAACACAAAAAAGAGATGAATTTA
GCCAAGTAACTAGGAGAAATGAATAAATCCATAGCAGAGAGCGAAACTTCTAAAAATGCC
TAAAAACTCCCTTAGAAACCTTAAACTTAATATAATACTTAAAAACCATAGATTTAAATT
CCGAAGAGTATAGCGAAAACTAAAGTAAAAGAGTAATAAAAGAATACTCGAGTGATAAGC
GATATTGAGCTTGAGCAGGAAATATTGGGTTAATTCAATATTGATATCAATAATCCACAT
GATGATGATGTGGTGTCAAATTTAGATATTGATCAATTCCTAGTTGAAGCTGGAAGCAAA
GGAAAAAATACTAAAAAATAGAATGAATAAGCACCACCCTAAAAAGGTGTTTAATTAAAA
GCGCAAATGAATGAATTAGGTGAAATAGAATATAATAATTACTAAAAATAATAAGAACGA
GATAAAGAACACATAAAGAGAAAAAAGGATGCCAAACGTGTTAGTGACTCTTTTGATATA
AATGTGGTGTCTAATGCAATGGATTAAATGCAATCGAGATTAGATAAAAAAGATACTAAT
GTCAAAGGTTTATAAAATAGGAAATCAGAGGGAGTATAAATTTAAACTTCTAAAAAGATG
GGAAGACCAAAGAAAGTGAAAGCTGAGGAAGTCGTAGAACAACAAGAATATAAATAAAAT
AAAAAAGATGATCAGCCTCAAATAGTCCATGAAGTACCAGATATTTTAGGATCATAAACA
TTGAAAAAGACAAAAGGTAGGCCAAAGAAATAGGTTGAGTCGCCTGTTTAATAACAGTAA
ATATAAAAAGAGATCGAATAATAAGCATCAAGTATCCCACTAAAAGACGAATATAAAAGT
AAGCCAAGTAAAGCTGATATCAAAGAGATATAAGAACCCCTTAATCAATCATAAAAAGCA
ACCACAAAGTCAAAAGATGCCCCCATAAATTCAATACCTAAAAAGGAAACAAAGAAATCT
ACTACAGAAACCCCAAAACCCACAAAATCATAAATAAAACCTACCTCATCTGGAATGTAA
AATACTAGCTCATTTTTCGAATTAAAAGATGATGAAGACATCTTAAAAGTGAAATACTCT
GAGGAATTGAGAAAAATTAGTAAATCTTAATTGAATGAGTAGGATTTGGCAGATTTAGAG
GAGTTAAGGGAATTAGAGAAGCTAGCAGGTGTGCGTTAGGACAGTGGTTACAAACATCAA
GACAGAAATGCAGAGATGCAAGCACTAATGAAAGATAAGTAGTTCCTACTTGATGAAGAA
ATCAAAGAATTGGATTTAAAACGTGAAGAGAATAGGGGAAAAGCTAAATCATGGGCTTAT
GAGAGAATTCGTTTAAGATAGGACTCAATGGAACTAAATCATGAGTTAGATTAGTAGGAG
GAAGAATCCTCGTCCGTGCTAGCAGACTCAGAATTTCTGTCCATATATGAAATCCCATCA
ATAAACAGCCTAAAAGTAGATTTAAAACTACCCAGGTTTAAACTTAATGAGGATAATGTA
AGCGGAGTTTTCACGATAAGTTTCTAATTTGACTATGACACATTGAAGCGTATGAAAGAT
AACTTCGATTTATACGAAAACATAGTTGCTTTCACTGATGGTAGTTCTATCAGAAACCCT
GGTAATGCTGGGTCAAGTTGTGTTTTTATGGGAAAGAGGAAGTAATAATCATATGATAAT
ATGCAGTTAATTAGAAATATGAATGGGATTAATGACTCAATAATGAATACTAACATCAAT
AAGAAACCAGACAGAGAATTTCTATTTGGATTGACAGTTGCATTGGGTTAAGCATCTAAC
AACTATGCTGAGTATACAGGAGTTATTATGGCATAACTGATTTTCTCTATGTTTAAACAA
AAAGAGATACACATTTTGACAGATTCTATGCTTGTTGTCAATCAAATCAAGGGTGTTGCC
AGGACCTAAAACTTTAGACTCATAGAGTTGATTAAAATTGTGCATTCACTTGCATTCAAA
TTTGAGACTATGAACTTAGACTATATTGAAAGAGAGCAAAATAAGTTGGCAGATGCTTTG
GCCAGAGAAAGCTCTAAAAATGCAATTACAAGTACAGGACCTTAATTTAGAGTAGTATTT
AACATGGAAAGTCTAATCTAAAATGTAAATTTCAAGTGA


>Contig17363.0.g63(protein)
MNLQKLSYLRSALQQKHHFSAQSLQFKQFYIGQNIESSFKFLNISQNKRNFSANSNNPSN
PISADKLKEIIMKHKKEMNLAKQLGEMNKSIAESETSKNAQKLPQKPQTQYNTQKPQIQI
PKSIAKTKVKEQQKNTRVISDIELEQEILGQFNIDINNPHDDDVVSNLDIDQFLVEAGSK
GKNTKKQNEQAPPQKGVQLKAQMNELGEIEYNNYQKQQERDKEHIKRKKDAKRVSDSFDI
NVVSNAMDQMQSRLDKKDTNVKGLQNRKSEGVQIQTSKKMGRPKKVKAEEVVEQQEYKQN
KKDDQPQIVHEVPDILGSQTLKKTKGRPKKQVESPVQQQQIQKEIEQQASSIPLKDEYKS
KPSKADIKEIQEPLNQSQKATTKSKDAPINSIPKKETKKSTTETPKPTKSQIKPTSSGMQ
NTSSFFELKDDEDILKVKYSEELRKISKSQLNEQDLADLEELRELEKLAGVRQDSGYKHQ
DRNAEMQALMKDKQFLLDEEIKELDLKREENRGKAKSWAYERIRLRQDSMELNHELDQQE
EESSSVLADSEFLSIYEIPSINSLKVDLKLPRFKLNEDNVSGVFTISFQFDYDTLKRMKD
NFDLYENIVAFTDGSSIRNPGNAGSSCVFMGKRKQQSYDNMQLIRNMNGINDSIMNTNIN
KKPDREFLFGLTVALGQASNNYAEYTGVIMAQLIFSMFKQKEIHILTDSMLVVNQIKGVA
RTQNFRLIELIKIVHSLAFKFETMNLDYIEREQNKLADALARESSKNAITSTGPQFRVVF
NMESLIQNVNFK