Identifiers and Description

Gene Model Identifier

Contig17309.0.g19

Standard Name

None

Aliases

Contig17309_0_g19

Description

HAMP domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17309.0.g19(coding)
ATGTAAAGAAAGTCAGGATAGGATTCATATCAAAATTTGAATAGCAATCGTAACTCACAA
GTTTTAAATCTGAGGACATCATCCCAGGGTAGTAAAAGAAACACCTAAAATAATCTTGCC
TAATCAGTTTCTTAAGCTACTATAGATTCCACAAGACGAAGGAGACAGCAACCTTAAAAT
AACGATAAAGTTTCTAGAAATAACCAAATTCAAAAGAATATAGAGAGAAATTAAAGCGCT
TCCTCTAATTTTGTATAATAAAATAAAGTAGAGAGTAGCAACTATTTATTTGAGAGAAGT
CCTTAATAAAATAGAGAATTTGATACCTATCAAAATAATAGCAATGTCAATTTATTTGAT
AAAAAAGATTAATAAACTACTGGAAATCAAATACCAAGTTACAATATCCCATTAAATTAC
AGAATTAATTAAAGCCAAAACTTCTCACTTTAAAACTTAAAAAATCAAAGAAATTCAAAT
AATATACTTGTGGATGCTGACCCATACAGCTCAGAAATGTATAACTTAAATCAGCAGGAT
ATTTCAGAAAATAGTCCATTGGGCATTAATCTACCTAATTTGATGAACTTAAATGGTTCT
CATTCGAAGGAAAGACCAAGTATGATAATAAATCCAACTTAAAACTCTGAAAACTTCTCT
CATAATAGAATCTAATCTCAAACCTATCAAAATTAACCATAGAATTAATTATCACAGCTG
CTAGGCCAAGAAGTTGAAAACCCCTTCAGGAAGTTGATATAAAATAAATAAAATTCATTA
AACAACAAAAGATAAATTAACTAGAATAGTGCTAACAACAGTGCGATAAACATATAAGAC
CAGCAAAATAATAAAAGTTCAGAATAAATCAGTCTCAAGCCAATAAAGTAGAATAGTGAT
GATTTTCAGTAAGATAATCAGACACCTGAAAGTTTAATGAGAGGAATGGGAGATTAACTA
AATGTGTTTAATAATTAGAATTTCAACGATTTGCCTAATTTTCTCTCGCCAATCTAAGAC
TTGAACAATAGTGCTATGGTAAATTAGTTTGATGCTTCTACTCTTTCACAAATAATTGAC
CCCAAATACTCAGATATACTGTCTAGATATCTCTAGCATTATTCTCCCAATTAACAGCAA
AATCATGATAATCAAAACACAAGCTAGGTGCTTTCGAATTAATTACAACCTTTGCTTGAA
AAATCATTCATGAATCTGACTAGACCCTCTGATGAATTTCAAACCCTGAAACAAATCTCA
GAGACAGTCTCTCAAAAACTGGACACCTTCGAGAAACAGCTTCTATAAATCCAACCCCAA
ACCAAGCTCCCTCTCCTCCAGCACAACGATACTCAAACTGACGATGAAATCACAAAACTA
GAAGTGGAGGGATACGAGGAACTTAAAGTTGAAGTTTTAAGATTGCAGGAGAGAGTTCAG
AGAGAAAAACATTCAAATTTAAGAGAGAAAGAGATGCACAGCTAAGAACTAAAAGCTTAC
AAAGATGAAATCAAGTAGCTTAACGAAGAGGTGAAGAGTCTCCAGGAATGTTTGAAAGTA
AAGAGAGACTTTGAAAATCAGTAAAAGTCTCAGTAGGACTTGATCATGAATACCAAAGAT
GGCTTGATAAAGCAGTTAACTTAAAAGTTACAAGAATCCACCAAACAAATGCAGGAGATC
AAGTTAAAACAACAATCCATGCAAGAGTAATATTAGCAAATCTCGATCTAAGAAGACTCT
AAAGTTGAAATTGAACTTTAAAAATTTGCTGAACATGAAAAGTTAAAGTTTGAAAGTCTC
TAACAGAAACACATCCATGCTCTAGAACAACTCAAATTATAAGAAAAAGCTAAGTTAGAA
AAGCTATAGCTTTAGTTTAACGATGAAAAGTTAAGGATGGCCAGTGAAATCGATGAATTA
AGAGAGTAAAACTATAAATAGATAGAGAGCATAAAGTAGCTATAGAATATATTGTCAAAA
TAGAAAGATTAAATAAGCAACTAACAAGAATTCTTAAATGCTGATTATAAAGGCTAACTA
GAGAAATCTATGAGTGATTTATCTGACAAGAGCAAAGTCATTGAGAAGAAAGAGCAGGAA
TTGCAGAGAACTAGAGACTACCTAGGTTAAATGGAAAAAGAGATTTTTAAATATAAAGAG
CAAATAAGACTGCTTAAACTAGAAGGGGAAGAGAAGGATTTAGAGTTAGATTCAATGAGA
CATAAGTCAAGTTAGAATTCCAAGAATCAGAATAGCTCTGACAGCTAAATGCTGAAGATG
AAAGATCTTTTGAAAGCGGAGTAAGCGAGATCCTAAGAAATGGAGGATCATTATAAACAA
GAATTATACTAGCTCAATGAGCAGATAGAAGCACTAAAATAAAATTAGGAAGAGTATGAA
GAAATGAAAGAAAAGGGATATTAGAAACTTAAAGAGCTGTAAGAAAAGATCGCTTAACAG
GACAAATAAATGCTAGATATATAGAATGAAAACGGAGATTTAATGTTCCAGCACCAATCA
CTCTCTTCTCTTTGTGATAACTAAGCTTTTAAACTGAGGCAACTCACAAACGAAAATAAA
GATCTCACAAAGAAAGTAGATGATCTTTAAAAGTTCAAAGTATAAGCTGAGAAGTTTGAC
ACAGAAGATTACGAAAACATAAAAAATGAGCTGGAATATGTAAAATCCCAAAACAGAGAA
CTAGAGGGTGACATCGAAGATTTAAGGGATCACATGCAATCATTAATAGATTAGCAGTCA
AAGAAAAAAGAAAGCATAAAAATGATTAAACAGCAGAAAAGTCAAATAGAGAGCGATTTC
AAACTTAAAGACGACCTTATGGAATAATTAAAGGAACAGCATGAAAAGTAAATTTAATCC
AAGACCACATAGATCAAAGAGTTATATAAGGAACTTGAAGAAACTTAAAATGAGTTACAG
CTTAAGAAAAATCACATTGACGATTTGGAATTGCAATTTGAAGAGCTATACCTTGAAAAA
GAGTAGGTATAGCATGATCATGAAGTGCAATTAAAGCAAATATCTGATTAATTTAATCTT
GATAAGCAAACTGATCAATCAGAACTCTAAACTCTGTAACAATAAAACTAAAGTTTAAAT
TCGAAAATCCTCTCAAAAAAGCAAAAGATACACACATTAAGAACTTCATCTTAACAACAG
AGTAACGAACAAATCATAAAATTGCAATCCTAACTCAAATTAAGAGATAGCGAGATGGAT
TAACAAGCCTAAGTTCTTATATCACAAATCGAGTAATAAAAACTAGAAACTTCCAAATTC
AAGCAGCAAAACCTAAAACTTTAGGAATAGCTAGATACTGAGCAATAAAACCTCAGAGAA
TTGTAAAAATAAGCACAAATTAAGCTGGATAATCTTCAAGACTAGCTAGATCAGAAGTTT
ACTGAAGTGAAAAGAGCATCATAAGTCAAATAGACTCAAGAAAGCTTGATTTAAACACTT
AATGAATAAATTAATGAACTGTAAACATCCAAGTTAGAAGAGAAATAAATGCTCAATAAA
TAGCTTGGCATATTAATTGATGAGAAGAATCAGCTGGAATTGTAATTGAGTTTGATATCT
AAGTAGAAAAAAGAATTAGAGTTAATGAATAAAGATGAGTCTAATGAGAGGGAGCAATTT
TTCATGAAGCTAGAGAAAAAGCGTGCAAAACTCCAGCAGATAAAATCAGACTTAAAAGAT
AAGTCCTCTCAAAGCCAAGAATTAGCCACTTAACTTTAAGAATTATAAAATGAACTAAAA
TCTAGAGTAGGTGACTCCCTGAAAGAAATCATGATGAAAAATCAAATGATAGAACGATAG
AAGAAAGAAAATGAGCAGTTATAATAGCAATATGAGAGCAGTCTAAGTGGGTAGGTCAAT
GAGCTATAGTCTGTTATCTAGCAACTATAGAAAGCAAAGAGAGACAAGGAAGAGAGTTTA
GAAGGTGAGATTAAAAAATTGGAAAGTAAATTAAATGAAGAGAAATTAAAGAGAGATAGT
GAGATATCACAATTGGAGAGCAGTTTGGATTAGATGAAGAAAGACATCAGAGAAAAAACT
AACACAATTGATGATAAAGAGAGAGACATAGAAAGATTAAAATCCTAGATAAACTCCTCC
TCTCAAAGCCAAAATGAGAAAGATTAGATAATACAGCAGTAATATGAAAAAGTGGAAACC
TTGTAAAAATAAATCCAGCATATTAGAGGAGAAGTAGAAGACAGAGAGTAGACCATAAGT
AAACTCAATTAATCTATACAATTAATGGCTGAATCTAATCTTCAGAAAATAACATAAATG
AATTAAAATCATGGGGCTTAGCAATAAGAGAGTCATTAGAAGATACTAGAACTGTAGTCA
TAGATTCAATAATTGGAGTAGAAACTTCATTAGATTAAATAAAAAGCTGATTAATTGGAG
CTTATTGAAGACGAAGTGAAATCTCTTAAATCTGAAAACCTCCAAAAAGACAGAGAAATC
TCTGAGTTAAGAAAAACAGTGTAGCAGCGTGACCACGAAATAAATGAGTTTTTCGAGACA
GAGTACAAAAATCTCGAAGACCAATATGAAAAGCTAAAATCCCTGAATTCCCAACAAGAA
ACTAAAATCAGAGTGCTCCTCGCTAGGAACGAAGAATTGCAGAAAGTTAAGGCTGAATTG
TAAATGAAAAGTAATCAGGATGAGAGTTCTGGTGCTAAGTTACTACAAGAGGATTTAAAG
AAGAAAAATCAACTGGTTATGATCAAAGATGCTGAAATCGACTCACTTAAGAAGCAAATC
AAGGATATGAGGGAGACTATAGACCAGAATGACAATGGGAAAGAGTTTTAAGAAGTGAAG
AAGCAATACACATTCGCAAAGAAGGAAAAAGAAATGAAGGACATAATGATAGAGCAACTG
AAGAAAGAACTGGAGAAAAACATAACTCTCATGATGGAAGCTAAGGAATAGGAGGCTCAA
ATGGCTTCTCAAGTGAACACTCTTAGTAAATAATTGGCTGAAGCTGCTGTCAAATAATCA
TTGAAATCATCTATGACTGGGGGTACAAGCAAGAAAGATGATAGCAAAACTTCCAAGAAA
AATAATATACCCACTTTTTGA


>Contig17309.0.g19(protein)
MQRKSGQDSYQNLNSNRNSQVLNLRTSSQGSKRNTQNNLAQSVSQATIDSTRRRRQQPQN
NDKVSRNNQIQKNIERNQSASSNFVQQNKVESSNYLFERSPQQNREFDTYQNNSNVNLFD
KKDQQTTGNQIPSYNIPLNYRINQSQNFSLQNLKNQRNSNNILVDADPYSSEMYNLNQQD
ISENSPLGINLPNLMNLNGSHSKERPSMIINPTQNSENFSHNRIQSQTYQNQPQNQLSQL
LGQEVENPFRKLIQNKQNSLNNKRQINQNSANNSAINIQDQQNNKSSEQISLKPIKQNSD
DFQQDNQTPESLMRGMGDQLNVFNNQNFNDLPNFLSPIQDLNNSAMVNQFDASTLSQIID
PKYSDILSRYLQHYSPNQQQNHDNQNTSQVLSNQLQPLLEKSFMNLTRPSDEFQTLKQIS
ETVSQKLDTFEKQLLQIQPQTKLPLLQHNDTQTDDEITKLEVEGYEELKVEVLRLQERVQ
REKHSNLREKEMHSQELKAYKDEIKQLNEEVKSLQECLKVKRDFENQQKSQQDLIMNTKD
GLIKQLTQKLQESTKQMQEIKLKQQSMQEQYQQISIQEDSKVEIELQKFAEHEKLKFESL
QQKHIHALEQLKLQEKAKLEKLQLQFNDEKLRMASEIDELREQNYKQIESIKQLQNILSK
QKDQISNQQEFLNADYKGQLEKSMSDLSDKSKVIEKKEQELQRTRDYLGQMEKEIFKYKE
QIRLLKLEGEEKDLELDSMRHKSSQNSKNQNSSDSQMLKMKDLLKAEQARSQEMEDHYKQ
ELYQLNEQIEALKQNQEEYEEMKEKGYQKLKELQEKIAQQDKQMLDIQNENGDLMFQHQS
LSSLCDNQAFKLRQLTNENKDLTKKVDDLQKFKVQAEKFDTEDYENIKNELEYVKSQNRE
LEGDIEDLRDHMQSLIDQQSKKKESIKMIKQQKSQIESDFKLKDDLMEQLKEQHEKQIQS
KTTQIKELYKELEETQNELQLKKNHIDDLELQFEELYLEKEQVQHDHEVQLKQISDQFNL
DKQTDQSELQTLQQQNQSLNSKILSKKQKIHTLRTSSQQQSNEQIIKLQSQLKLRDSEMD
QQAQVLISQIEQQKLETSKFKQQNLKLQEQLDTEQQNLRELQKQAQIKLDNLQDQLDQKF
TEVKRASQVKQTQESLIQTLNEQINELQTSKLEEKQMLNKQLGILIDEKNQLELQLSLIS
KQKKELELMNKDESNEREQFFMKLEKKRAKLQQIKSDLKDKSSQSQELATQLQELQNELK
SRVGDSLKEIMMKNQMIERQKKENEQLQQQYESSLSGQVNELQSVIQQLQKAKRDKEESL
EGEIKKLESKLNEEKLKRDSEISQLESSLDQMKKDIREKTNTIDDKERDIERLKSQINSS
SQSQNEKDQIIQQQYEKVETLQKQIQHIRGEVEDREQTISKLNQSIQLMAESNLQKITQM
NQNHGAQQQESHQKILELQSQIQQLEQKLHQIKQKADQLELIEDEVKSLKSENLQKDREI
SELRKTVQQRDHEINEFFETEYKNLEDQYEKLKSLNSQQETKIRVLLARNEELQKVKAEL
QMKSNQDESSGAKLLQEDLKKKNQLVMIKDAEIDSLKKQIKDMRETIDQNDNGKEFQEVK
KQYTFAKKEKEMKDIMIEQLKKELEKNITLMMEAKEQEAQMASQVNTLSKQLAEAAVKQS
LKSSMTGGTSKKDDSKTSKKNNIPTF