Identifiers and Description

Gene Model Identifier

Contig17275.0.g47

Standard Name

None

Aliases

Contig17275_0_g47

Description

Dynamin central region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002183209.997093137033517e-262Dynamin central region family
protein
SGDYKR001C4.0000050475224054e-168VPS1 SGDID:S000001709, Chr XI
from 442722-440608, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17275.0.g47(coding)
ATGGAAAAATTAATCCCACTCATAAACAAACTTTAAGAAGTGTTCGCAAGAACCAAAGTT
TCATTCTCAGTTAACCTACCATAAATAGTAGTCGTTGGAGGGTAATCTTCAGGAAAAAGT
AGTGTGCTAGAAAGCATTGTTGGCATAGATTTCTTACCAAGAGGCACAAACATCGTGACA
AGACGTCCAATCATTATTCAATTGACAAACACACCCTATGCTGATAAACCATGGGCTGAA
TTCACCCATAGATCAGCGGAGAAGTATTATGATTTCCAGAAAGTGAAGGAAGAGATTGAA
ATGGATACAAATAAATTGTGTGGAACTAATAAGGACATCTCCCCTACTCCGATTGTGTTG
AAGATCTATTCTCGCTCAGTAGTTGACCTCACACTCGTTGACTTACCAGGTATGACTAAG
ATACCCACAGGAGACTAGCCTCATGATATTGAATCAAAGATTGCCGACCTTGTGTATAAA
TTCATCTCACCTAAAACTGCCATTATCATGGCTGTGTGTGCAGCAAATGTTGATCTGGCT
AATTCTGATGCCTTGAAAATGGCTAGAAGAGTTGATCCATCAGGTGAGAGAACAATTGGA
GTAATTACTAAAATTGATTTAATGGATGAAGGCACAAATGCAATCGATTTACTCCAAGGT
AAAGTCTACCCTTTGAAACTAGGCTATGTTGGAGTCGTCTGCAGATCACAAAAGGATATT
TTATCACAAAAGCCAATTGAGGATGCCCTAAAGAGTGAAGAAAAGTTCTTCAAAACAAGT
CCAGTTTATTATCCTTTTGCTTCAAGATTAGGAGTGGCATATCTATCACATAACTTGAAT
CTTGTAATTGTAAATCACATAAAAAAGAATCTGCCAGAAATAAGATCTTAAATTACAGCT
TTACTTTTCCAGAAAGAAAAAGAGTTAAGAGCTCTCTAACTTTTTAAGGATGACTAATCA
AATGAAAGTCAACTTATTTTGAATGTTATCGCTAAGTTTGCTTCATCATATGGTGAGTTT
ATTGAGGGTAAATTTGTCAAAGAGACAGCATCAGAGTTGATCGGTGGAAGCAGATTGAGT
TACATATTCTATGAAGTTTACAATAAAATCTTAAGTGATGTTGATCCATTCGACGCACTC
TCTGATGAAGATCTTAAGACTGCTATAAGAAATGCAAGCTCTTTAAGACCCAATCTCTTT
GTTCCTGAAGTTGCATTTGAAGTGCTCTCCAAGCAACAGATACTTAGATTAGAATCTCCA
TCTCTTCAATGTGTTCAACTTGTCTATGAAGAGTTAAGAAGAATAGTTACTGAAGTAGAC
ATGCCAGAATTTACTAGATTCCAAAACTTGAGAAAAAAGATCATTGAAATCATGTATCAA
CTCTTGACTAAATCCTTGGTGCCTTGCAATCAAATGGTAAAGAATCTGATAGTTATTGAA
GATTCCTATATCAACACCTATCACCCAGATTTCATGGGAGGCGCAAATGCTATTTTCAAT
GTATTTGACCCTGCAGCTTACTAAGCTCAACAAGCCAAGCTTGAAAAATTCTAGGAAGAG
AGACAACAGCTGAGCTTTGAGGAGGTTAATGATGACTCATCATCAAAGGCGTCTAAGAAG
AAGAACTAGAAGTAACAACCATAAAATTCTGGAGGTTTGTTTAGCAGTTGGTTTGGAGGC
AATAATTAATAAGTCCCCGATGATGAAGACGAAAATAACAGTGGTTCACATCTAAGCGAG
CTAGAATTCGCTAAGTACAGAAACGATCAAGATTTCGAAATAAATAAGTATATGTAAAAG
AACATAAAGCCAGTTCATCTTCCAAACATGCCCACTTCCATCAGAGCAACAAAAGAAGAA
ATGGGCCAGAGTTCCCCAAGATCTTAAATGGAGATTCACATCATAAAATCCCTTATCACT
TCTTACTTTAACATTGTGAGAAAGAATTTGAATGATTTGGTGCCCAAAACTGTAATTGCA
ATGCTTGTAAACAAAACTAAAAATCAAGCATAGAGAGAACTAGTTCAATAAATCTATAAT
AACTCTGTCGACCTTAAAGAATTACTAGTAGAAGACTTAGCAACAGTTAAGAAAAGAGAA
ACTTGTTAAGAAATGGTTAAGAGCCTCCGATAAGGTTTGGAATACTTAAATGAAGTAAGA
GACTTCTATTTTGATGAAGAACCAATGAAGTTTAATTGA


>Contig17275.0.g47(protein)
MEKLIPLINKLQEVFARTKVSFSVNLPQIVVVGGQSSGKSSVLESIVGIDFLPRGTNIVT
RRPIIIQLTNTPYADKPWAEFTHRSAEKYYDFQKVKEEIEMDTNKLCGTNKDISPTPIVL
KIYSRSVVDLTLVDLPGMTKIPTGDQPHDIESKIADLVYKFISPKTAIIMAVCAANVDLA
NSDALKMARRVDPSGERTIGVITKIDLMDEGTNAIDLLQGKVYPLKLGYVGVVCRSQKDI
LSQKPIEDALKSEEKFFKTSPVYYPFASRLGVAYLSHNLNLVIVNHIKKNLPEIRSQITA
LLFQKEKELRALQLFKDDQSNESQLILNVIAKFASSYGEFIEGKFVKETASELIGGSRLS
YIFYEVYNKILSDVDPFDALSDEDLKTAIRNASSLRPNLFVPEVAFEVLSKQQILRLESP
SLQCVQLVYEELRRIVTEVDMPEFTRFQNLRKKIIEIMYQLLTKSLVPCNQMVKNLIVIE
DSYINTYHPDFMGGANAIFNVFDPAAYQAQQAKLEKFQEERQQLSFEEVNDDSSSKASKK
KNQKQQPQNSGGLFSSWFGGNNQQVPDDEDENNSGSHLSELEFAKYRNDQDFEINKYMQK
NIKPVHLPNMPTSIRATKEEMGQSSPRSQMEIHIIKSLITSYFNIVRKNLNDLVPKTVIA
MLVNKTKNQAQRELVQQIYNNSVDLKELLVEDLATVKKRETCQEMVKSLRQGLEYLNEVR
DFYFDEEPMKFN