Identifiers and Description

Gene Model Identifier

Contig17235.0.g46

Standard Name

None

Aliases

Contig17235_0_g46

Description

GCC2 and GCC3

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008353900.0000000039998859049333245GCC2 and GCC3 family protein
SGDYOR216C0.000000009996807949091551RUD3 SGDID:S000005742, Chr XV
from 748979-747525, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17235.0.g46(coding)
ATGTTAGAAAATAGAGCGAGATCTAATCGAATCTTGGCTATTCTACTATTGTCAACTGTG
CCTCTTGTTTAATCCCAATCTTATTCTTGCACTGCTAATTGTGTGGAGTGTTATGGGCCA
TCATCCAATTACTGTGTAGCTAGTTGCCCAGATGGGACAACAGCAGATACTTATGATTCA
ATTTGCAAGTCAACCTCATACGATACAGATACTCCTTGTCTACCAGGAACCTATAACGGT
TCTCCGATGGCAACAGATAAAGATAATTGCAAGGCTTGCGATCCTGGCAAGTATTGTACA
ACTTATGGAAACTCTTAAACCACCAATTAATGTGCGTTGGGTTATTACTGCACTCAAAAT
AATACTTATGCGAAACCAATGCCAGACTTGTTAACAACTTCTGAGCTTCCCAGTGAGTTT
AAAGTTTTTACTGGAGGTTTTTGTGTCCCTGGATAGTATTGTCCAGCTAAAGCAGTGACA
CCAATCGATTGTGACCCAGGCTATTACTGTCCCTATCATTTATAATATGAGGTAGATAAG
ATCAATAATAAGTGTAGAGCAGGATTTTACTGCTCAGGAGGAGCAAAAATACCTAATCCA
ACTGATGGTATAACTGGTAACATATGTCCAACTGGAAAATATTGCCCAGAGGGTTCTTCA
AATCCAATTCCTTGTTCTGTTGGTACTTTCTTGAGCTATTAAGGAGCTTCAGCTAAAACA
GAATGTCAAGCTTGCTCTCCAGGCCAATACTGCGGTTCTTAGGGACTTGACGCAACTTCC
GGTGATTGCTCAGCTGGTTACTACTGCCTTAGTGGACAATCCTCAGCCACACCAATCTAA
TACTATTGCCCAATAGGATCCTACTGTCCATAAGGCTCAGTATAACCAATGAAATGCCCA
GTCGGTTAATTTACCTCAACTCAATTAGCCTCAACCTGCTCTGATTGCTTGGAGGGGAAA
TACTGTACCGAGAAAAACATAGCATAAGAGTGTGATATTGGAAACTACTGCCCTACTGGT
GACTTCAAGATTCACTGTCCTTTAGGTACTTACTCACCAAGTATTGGACTTACTAAAGAA
TCATAGTGCTTAGCATGTCCCAAGGGTAAATCTTGCCAGACAACAGGTTTGAGATCATCT
TCTTCAAACTGCGCTGCTGGTTATGTTTGTGAAGGATCAGCAATCAGCCCAAAACCAAAT
GATGCTACTCAAGGAGGAAGAATGTGCAAACCTGGTTATGTGTGCCCTAGTGGATCATAT
ACTGAAAACAAATCTTCAAAAGGAAGATATCAGCCAGATTATGCAGCCTCTTACGCGACT
GCTCTCTGTGAAGAGGGCTATTACTGCCCTGAGGGAGAAGCCATTAAGAATAAATATATT
TGCACGCCAGGTTATTATTGTGATGGAGGAAGTTCAGCCCCCACTTAATGCCCTAAAGGT
ACCTACACATTGAGTGTAGGAGCTTCAAGTATCGATCACTGCCAAGAATGCCCAGGTGGT
ATGTACTGCGACTAGTTAGGTTTGATCACTCCTTCGTTCAATTGCAAGGAAGGTTATTAC
TGTCCCAACGGTTAAACTGACTAGGATCCTATTTAATATCTATGTCCAATTGGATATGCT
TGCCCAGAGAAAAGTATCTATCCTACTCAATGTAGCCCTGGATACTATCAGCCTGCCACA
GGTAAAGCTACTTGTGATGACTGCCCAGAGGGTTTCTATTGTGAAGGATTTGGCGTAACG
TCTGCTACATCTTGTGAACTTGGTTACTACTGCCCAAAGAACACTTAGAATAAAGACCAA
TACCCTTGTCCAGCTGGGACTTACAATCCAAATGCAGAAACAAAAGATATTTCAGGGTGT
TTATAATGCCCACAAGGCTACTTCTGTGATAGACTAGCTCAGACTACCTACTATGGAAAA
GTATTTGCTGGTTACTATTCCAATATACTTGGAAACTAAAAACCCGATCCATTACTCTGT
CCTAAGCACGCATATTGTGAAGAAGGCTCAGTATTACCAACTCCATGTGATTAAGGATAT
ATGACAGTATCTTGGGGCTCTACTTAAGCTGCCGATTGTGTGAAATGCTAAAGAGGTCAT
TACTGCAAATTCAATCTTTACTTCGCCTCATTAGCAGATATCTCTGATTACAACTAGAAC
TTAGCGGAGATTGATTGGAGTTACTATGGACTATGTTTAGATGGTTATATATGTCTTGAA
GGATCTTATACCAGTACTCCAACAGATGCAACATTAGGAATAGGATATATATGTCCAGTA
GGATATTACTGTACCTCAGGTGCCTATGATAAGAGGCCATGTCTTCCAGGCACTTATAAC
GAATATGAAGGTTAACATTAATGCTCAGCTTGCCCAGCTGGTTACTATTGTGAAGATTTT
GCTGCCACAGATAAAGTCATTTGTCCCAAGGGAATGTATTGTCCTGAAGGCTCCGCTTCA
CCATAACCTTGCAAACCTGGAACTTATAACAACGTCACTGGGTTAACTGCAGAATCTGAG
TGCACTTTATGTGATTCCACTATGTATTGCGAGGGTTACGGACTTACTGAAGTCTCCGGA
TTATGTGCCGATGGCTATATTTGTGGTTCAGGGTCAAGTTCTTAAAACCCCTATGAAATT
GTAGCTCAAGCTGGAAAAAATACAAACGGTATCTGCCCAGCTGGATACTATTGCAAATCA
GGTGATTTAAAGCCAACTGTATGCCCCACGGGTACTTATAATGACGACTATGGTGGTGTT
GATTGCAAACTATGTCCTCCAGGTAAATATTGTCAAACAACTGGATTGATTTCACCAACT
GGTGATTGCTAACTGGGATACTTCTGTGAGTGGGGTGAAGCTGCAGCTGCTCCAATTGGT
AAGCAATGTAATGGTACTTTTGGTTACTGTCCTAAGGGTGCAGTAGCAAATTACTCTTGT
CCCTTCGGATATTTATTGAACGAAAATAAAGGCATTTGTGATCCATGCCCTGATGGTTAT
TAATGCAGAGACAATATTGTTAAGATCATCTGCCCAGCATAACACTTTTGCAATGAATCA
ATAAAATATCCTTTAGGTAGACTTTGTCCAAATGGAACCTATTCAAATAAAACTGGTCTG
AAAAATGCTGATCAATGCGGAACTTGCCCAGTCGGTATGTTCTGTCTGGGTGGGTTTACA
GTGGATAATTGCACTGCAGGTTATATATGTAATTATGGTGCAAACTCCCCAACACCTGTT
AAGAGTACTGGTGCTTACCCATGCCCAAGAGGATATTATTGTCCAAAGGGAGCTTAAGCA
GTTGAAGTATGTCCTGTAGGAACTTACACGTTCAGAGAAGCGGCAATGTCTATAGATTTT
TGTGACTATTGCTAGGCAGGATACTACTGCTCATATGGATCGATTGAACCAACAGATTGC
CCAGAAGGTAATTACTGCCCGATTGGATCTCAAGAACCTACAAATTGTACAGTTACTAGG
TACAATCCTTACAATCTTGGCAAAAGTTTTGCTGATTGCTAGGCATGCAAAGGTGGATAT
TATTGCAACAGTACTGGATTAGGTAATTTGTTCTCATATGGCGCAACTTACAAATGTCCC
TATGGAAACTATTGTCCATTAGGTACATGGAGACCATATCCTTGTAAAGCTGGCAGCTAT
GCTGATGAAACACTTAGATTACCACCTTCAACCCCTGCAGAATGTGTCACATGTCCAGAA
CACTATTACTGTCCAACATAAACAGCATTTAGATACAGCTATCCTTGCCCCTCTGGAACT
TACTGTCCAGCTGGCTCAGCTTACCCAAAACTTTGCCCTCCAGGAAAGTATTGTAAACCA
ACGCTTGTTAAGAATCAAACTGTGATCTCAGTAGTAACTTGCCCTGTTGATCACTACTGC
CCATTAGGTACTGGAGAACCCATAAAATGCTTCAAAGCTAAGGGAGAGATCTGCAATTTA
GGATCTAGTTTCCCATCCAATACCAAAACTGATGCTTCATTATGTGGACCAGGCTTCTAT
TTCGGCTACGGAAAATGTCTTTTATGTGAGCCAGGATATGTTTGTGTTGGAAATACTAAT
ACAAAGTATCCAGTAAGTGTAGCTAAAGAAGGAGGATATGAATGTCCAATCGGTAATTAT
TGTCCTTCAGGTAGCACATCTCCAACTAAATGTCCAAAAGGTACTTTTAGGCAAACACCT
CTTGGTAAATCTATCGCCGATTGTTTCGACTGTCCTTCTGGATCCTACAACACCTTACTC
GGCTAATCGAACTGCATTAAGTGTGGAAGAGGTTCAAACAGCTCTGCCGACTTCAGCGTT
TGCAGATGCACTGGTCAGTTCAGGATATGGAGATTAAGTGATAATTAATGTGTGTGCTAA
AGTCCATATACTGAACCATAACTTGTCAATGATGAAGCCTAAACTTCTAAAGATATTCAA
GATTGCGTTCCACCAGTTTCTAAGGTATGTGGCACAGATATGCATTTCGATTAAGTTTAA
GCATTATGTATTTCGAATAATGTTTGCTCTGAAGCTTCACTTTGTAATGGAGAAGGTAGT
ACTGCAGGTTATTACTCCTCTTCATAGTAAAAATGTATGTGTTCAAATGTCGACTCTTAG
ATTAGTAGCTACTGTGATGATACATGCATTTCAAAGTCAGTTAAGGCTTTACTAACTAAT
ACTTCGATGATATGTTTGACTGATGGAACTACAAAGAAATATTTCAATCAATCAGATTTC
GGTACCAGCCTTTTCTTGGATGGCGTTACTTGCACTGGAGCAAGTGAATGTTTGATTACT
GGAGTCTAAAATAGCGATGGAAGCATGGGTGGATCTTATGAAGCTCTTCCAATTTTTGTT
CAAAAATGGAAATCAATTTTCCCTAAATATGTTTCACCATATGGAACGACTGTATCTAGC
TCCACTAAGATAAGAAGATTCTTGCAATCAAACAGTAGTTAGTTGATAGAATCATCAATA
ATATGCATTAAACCAAACATCCCAGTTTCTTTCTCAGTTTCAAAGACTCACTTCCCTGTT
TATGTTTCTACCTCCCTCTACAACACAAATCCCTCATTCGATTATGGACTCTTTGATACT
GTTAAAACTAAGCTTCTCAACGCTGGCATGGACATTTCAACTTTCTTCTTCACCTTTTCA
CAAGAGGGAGTATATGTCTTTGGTGACTACGCAGACCTCTATAACTCTCAAACAATAATC
AAGGTTGATGATTAATGTCCAGCAACCAAGAACATTTATCCCATGACTGAGGAAAACTTG
CAACTCCTGAATATTAAGCCTCAAGAATTAAAGCTCACAAAGATGAATGAAGGTCTTATT
GCCATTCCAGTTGTCTTCATTTTCTTGACATTCGTATCCACAGCTGTTTAAAAACACATA
GAAAATAAAATCTTGAAAAAGGAGTTGGAGAGAAGATTGAAGAGAGCTGGTAGACGCAGA
AACTTCCACAATGAAGATGGTAAGCTTGATAAGAAGCAATACTTGGCTGATTTGTATAAG
TTAATTAAGGATAACTTGGAAGAAGTCAAGAAACTCATAGACTCACATGATTCAAAAGAT
AGTTTATATAAATTGCTTAAAGATAAGACTTCTCTTGCCAAAGAATTAGGTGATGACAGC
AAGAATGTGATTGAGTAGTTGAAAGATCAACTAGGTAAATTATTGGGTGACATGCGCTTC
CCAGATGGCAGAGCTCTAAAAGAAGTCCTAGCAGAAAGACTTCTTTAGAGAAGACTGCAT
GAGGATGATGAGACCAATCATGATGGTGAAGATGAAGGCATATAACATCTCAACGACTCT
CTGGACAGACCTGAATCAGCTTACGATGAAGACGAAGAAGAAGAGGAAGTTAACCTTCTA
TAAATGAACACTTAGGAAGAATTGATAGATGCAGCAGGCTAGGGACTCATGGATGATGAG
GATCACAGGAAAGAACTTCAAAGAATCAAGAGTCAAAATCAAATGGACTAAGACCAAATT
AACAACATGTTGAGACTTAAGAAGGAGCAGGAAAAGAGAAAGAACCAATTCAAAGAAAGA
GTAGGTGATATGGATATCGATCAGGACGACAAAGATAACCTTATGGAGGGTTTTGACAGT
AAGATGCTTCAATTAGACAACTTGATTAAAAACGAGAGCAAGAATTAAGATTCCTCACTA
GAAGATAAACTAGCCGCAAGAAGAGCCAGAAAGAACGCTCTTAAAGATCAAATAAGTGAT
AGAGTATAGGCTAAATAAGATAGGTTAGACTAGCTAGTTGAAGACCAGGACAGAATGATT
GAGGAATTCGATGATATCATGCAAAATGGAGTCAACCAAACACAACTCAAGGAAATTTCA
GATAAAGAGAAGGCTAAGGCTCTGTCTAATCTAGAGAGATAGATGGAGGAAAAGCTGTCT
GCTGTAAGAGACGAATATATGGAGCGAATGAAGAATGCAAGAAGCAGTGATGAGAAAGAA
AGAATCCTTGATGAAATGCACAACAGACTCCAAAATATCGAGGAACAACTAAGAAAGGAG
AAGGCTGAATAGGAGAGAAACCTAGATAAAATATTGAAGGAGAGGCAAGCTAGAAGAATA
AAGAAGATGGCGAAGGAATAGGATAAGATGATTGGAGAGAAAGGCAAGGAGATTCAAGAT
CTGTAGAGAGACATTGAAAAAGAGAAGGCTTTAATTTATGCTGAAAATGGAGGAAAAGAT
GCTGAAGAGACTGTAAATGACACTATCAAGCAAAAGATTGCTGATATTTTGAAGAAAGTT
GATAAGAAGTAGCAAGCCCTTGAACTTGACTAAAACGACAAAGATGCAATGGAAATTTTC
AAAGTACAGCTAGGTTTAGAAAAAGAAAAAGCTCTGAATAATGTAGAAAGAGAGCTGGAA
GAGCAAAGCGACGATGACAGATATAAAATTGAGCAAGAACTCAATTTGAAACTTTAAAAG
TAAAGAGATGATTATGCTAATAAGATCAAAGCAGCCACCTCATAAGAGGAGAGAACCAAA
CTCATGAAGGAAAGCGATAAAATGCAGAGAAAGATCTAAGAGGAAATTAATAATGAGCAA
TTGAAATAGGAGAGAATGCTTGAAGAGAAGAAAATGAACAGATAGAGCAGAAGAAAGATC
AAGGAAATGGAGATTGATGCCAGTCATCTCAGTAAAATAGCAGAGAAGGAAATGGAGCTT
CTGAATAAAAAATTCAACAAGCAGGATTAGGAACAAGAGAAGGTATTTGATTAAGAGCTT
CAAAACACTGTAAATAAGATGCAAAATCAGAAAGATGGCAAAAGTGAACAGGCCCTTATT
ATGGTCAATGAAGCTGGCGATGATATGCTTAAGAAACGCTTGAAAATGCTCATTAATAAG
CAATTCTTTGAGCTATAGAAGTATCTTGGTGCTCTCTATACTCAATCAGCTATGGACAAA
CTAATTGCCAAAGAAAAAATCAAGGAAAAATACAAAGTTTTGGAAGAGGAAGCTTATGCC
ACTTTAAGCAACGATAAACTTCAAGCCAGACTAAATAGTCTTAAGGAGGAATAACATTTA
GAGCTCGGCATGGTAGACATGCAAATAGACAAAGATGAGAAAGAAAAGGAAGCTGATTTG
AGAGAGAAACTTGAAAACAAGTTTTCTCAAGAAAAGCAATCGCTTTATCAATAAGACTTG
AACAAGAAGCAGAATTTACTTGAGTAGATTATTGAAAACAATCAAGATGATGAATTGGTT
CAGCAAGTCGGATAATAATTGATAGAAAACACTAAGCAAAATACTCAAGAGGAACTGTAA
AAGTTGGAGCAAGAGAGACAAGATAACATTGATAGGATTAAGTTGCAAATTGTTGCTGAA
AATGAAGCAGAGTTATAAGACATGCAAAAGAAAATTGAGGAGTAGATGAATAAAGAGAAA
GATGCAGTTGAAAACAGAATGAAACAAAAGAGAGATGAAGTTATTGGCGATAAGAAGAGA
AAACTAGAGGAGAAGATTAACGAAATGAAGGGGACACTCAGTGATTATCAGAGAGAAATG
ATAATGAAGCAATATTAGAAAGAGTTAGATGCCCTTGAAAGAGCAATCGCAATGGAGAGA
GACAACCAGCTCCAAAAGATGAGACAAAAGTTAATTAAGAGAAAGATTGAAAGAGAAAGA
CTCAAGAAGGACGAGGAGTCAAAATCAAAGATGGACTCATTGAAGACTAAGCTTAGAGCT
CAAATCAAGAATCAGATCAAATCCGATAGAACTGAACTTAACAACAAATAGCCTGGTCTG
GTAAGCTAAGTGCCTCAGAAAGAAATCAAAACTCAGAGACCCTCGACTGCTGCCTAGTAG
TCTCAAAGCTTGAAAGACAAGTTGAAGAGAATGCTTGCTAAATGGAACAATCACAAAGAT
GCAGCCAAGCAAGACTTGGATGATATTCAAAATATTTGGGAAAAGAACTCATAAGCTGAC
TCAATGAAGTCAAACATTACTAAAATGAGTTTAATGAGTAAGTTCAGCAAGGTCACAGGA
ATGAGCAAGGCCACCGGTGCCTTTGGAGGTTTAGGAAATAATTTAGCCAGTTAAAACAAC
TAAGTCTAGAATTTCACAATGGAAGAGCTTATCAGAAGAGTGAGAAGAATTGAGAAACTC
ACTGAAAAGATGAGTGAGCATGGACCTCCCACAGTCGTCTTAAAATAAGCACAGAGTGAA
ATTTCAAAAGTTTCCAAAGTTATTAAAAATGGTAGAAACTTATGA


>Contig17235.0.g46(protein)
MLENRARSNRILAILLLSTVPLVQSQSYSCTANCVECYGPSSNYCVASCPDGTTADTYDS
ICKSTSYDTDTPCLPGTYNGSPMATDKDNCKACDPGKYCTTYGNSQTTNQCALGYYCTQN
NTYAKPMPDLLTTSELPSEFKVFTGGFCVPGQYCPAKAVTPIDCDPGYYCPYHLQYEVDK
INNKCRAGFYCSGGAKIPNPTDGITGNICPTGKYCPEGSSNPIPCSVGTFLSYQGASAKT
ECQACSPGQYCGSQGLDATSGDCSAGYYCLSGQSSATPIQYYCPIGSYCPQGSVQPMKCP
VGQFTSTQLASTCSDCLEGKYCTEKNIAQECDIGNYCPTGDFKIHCPLGTYSPSIGLTKE
SQCLACPKGKSCQTTGLRSSSSNCAAGYVCEGSAISPKPNDATQGGRMCKPGYVCPSGSY
TENKSSKGRYQPDYAASYATALCEEGYYCPEGEAIKNKYICTPGYYCDGGSSAPTQCPKG
TYTLSVGASSIDHCQECPGGMYCDQLGLITPSFNCKEGYYCPNGQTDQDPIQYLCPIGYA
CPEKSIYPTQCSPGYYQPATGKATCDDCPEGFYCEGFGVTSATSCELGYYCPKNTQNKDQ
YPCPAGTYNPNAETKDISGCLQCPQGYFCDRLAQTTYYGKVFAGYYSNILGNQKPDPLLC
PKHAYCEEGSVLPTPCDQGYMTVSWGSTQAADCVKCQRGHYCKFNLYFASLADISDYNQN
LAEIDWSYYGLCLDGYICLEGSYTSTPTDATLGIGYICPVGYYCTSGAYDKRPCLPGTYN
EYEGQHQCSACPAGYYCEDFAATDKVICPKGMYCPEGSASPQPCKPGTYNNVTGLTAESE
CTLCDSTMYCEGYGLTEVSGLCADGYICGSGSSSQNPYEIVAQAGKNTNGICPAGYYCKS
GDLKPTVCPTGTYNDDYGGVDCKLCPPGKYCQTTGLISPTGDCQLGYFCEWGEAAAAPIG
KQCNGTFGYCPKGAVANYSCPFGYLLNENKGICDPCPDGYQCRDNIVKIICPAQHFCNES
IKYPLGRLCPNGTYSNKTGLKNADQCGTCPVGMFCLGGFTVDNCTAGYICNYGANSPTPV
KSTGAYPCPRGYYCPKGAQAVEVCPVGTYTFREAAMSIDFCDYCQAGYYCSYGSIEPTDC
PEGNYCPIGSQEPTNCTVTRYNPYNLGKSFADCQACKGGYYCNSTGLGNLFSYGATYKCP
YGNYCPLGTWRPYPCKAGSYADETLRLPPSTPAECVTCPEHYYCPTQTAFRYSYPCPSGT
YCPAGSAYPKLCPPGKYCKPTLVKNQTVISVVTCPVDHYCPLGTGEPIKCFKAKGEICNL
GSSFPSNTKTDASLCGPGFYFGYGKCLLCEPGYVCVGNTNTKYPVSVAKEGGYECPIGNY
CPSGSTSPTKCPKGTFRQTPLGKSIADCFDCPSGSYNTLLGQSNCIKCGRGSNSSADFSV
CRCTGQFRIWRLSDNQCVCQSPYTEPQLVNDEAQTSKDIQDCVPPVSKVCGTDMHFDQVQ
ALCISNNVCSEASLCNGEGSTAGYYSSSQQKCMCSNVDSQISSYCDDTCISKSVKALLTN
TSMICLTDGTTKKYFNQSDFGTSLFLDGVTCTGASECLITGVQNSDGSMGGSYEALPIFV
QKWKSIFPKYVSPYGTTVSSSTKIRRFLQSNSSQLIESSIICIKPNIPVSFSVSKTHFPV
YVSTSLYNTNPSFDYGLFDTVKTKLLNAGMDISTFFFTFSQEGVYVFGDYADLYNSQTII
KVDDQCPATKNIYPMTEENLQLLNIKPQELKLTKMNEGLIAIPVVFIFLTFVSTAVQKHI
ENKILKKELERRLKRAGRRRNFHNEDGKLDKKQYLADLYKLIKDNLEEVKKLIDSHDSKD
SLYKLLKDKTSLAKELGDDSKNVIEQLKDQLGKLLGDMRFPDGRALKEVLAERLLQRRLH
EDDETNHDGEDEGIQHLNDSLDRPESAYDEDEEEEEVNLLQMNTQEELIDAAGQGLMDDE
DHRKELQRIKSQNQMDQDQINNMLRLKKEQEKRKNQFKERVGDMDIDQDDKDNLMEGFDS
KMLQLDNLIKNESKNQDSSLEDKLAARRARKNALKDQISDRVQAKQDRLDQLVEDQDRMI
EEFDDIMQNGVNQTQLKEISDKEKAKALSNLERQMEEKLSAVRDEYMERMKNARSSDEKE
RILDEMHNRLQNIEEQLRKEKAEQERNLDKILKERQARRIKKMAKEQDKMIGEKGKEIQD
LQRDIEKEKALIYAENGGKDAEETVNDTIKQKIADILKKVDKKQQALELDQNDKDAMEIF
KVQLGLEKEKALNNVERELEEQSDDDRYKIEQELNLKLQKQRDDYANKIKAATSQEERTK
LMKESDKMQRKIQEEINNEQLKQERMLEEKKMNRQSRRKIKEMEIDASHLSKIAEKEMEL
LNKKFNKQDQEQEKVFDQELQNTVNKMQNQKDGKSEQALIMVNEAGDDMLKKRLKMLINK
QFFELQKYLGALYTQSAMDKLIAKEKIKEKYKVLEEEAYATLSNDKLQARLNSLKEEQHL
ELGMVDMQIDKDEKEKEADLREKLENKFSQEKQSLYQQDLNKKQNLLEQIIENNQDDELV
QQVGQQLIENTKQNTQEELQKLEQERQDNIDRIKLQIVAENEAELQDMQKKIEEQMNKEK
DAVENRMKQKRDEVIGDKKRKLEEKINEMKGTLSDYQREMIMKQYQKELDALERAIAMER
DNQLQKMRQKLIKRKIERERLKKDEESKSKMDSLKTKLRAQIKNQIKSDRTELNNKQPGL
VSQVPQKEIKTQRPSTAAQQSQSLKDKLKRMLAKWNNHKDAAKQDLDDIQNIWEKNSQAD
SMKSNITKMSLMSKFSKVTGMSKATGAFGGLGNNLASQNNQVQNFTMEELIRRVRRIEKL
TEKMSEHGPPTVVLKQAQSEISKVSKVIKNGRNL