Identifiers and Description

Gene Model Identifier

Contig17068.0.g82

Standard Name

None

Aliases

Contig17068_0_g82

Description

Proteasome subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603
  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL011C1.9990871925214856e-61SCL1 SGDID:S000002979, Chr VII
from 475247-474489, Geno...
T. thermophilaTTHERM_001069602.0007467515522948e-59Proteasome A-type and B-type f
amily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17068.0.g82(coding)
ATGAGTTTTGAGAAATTGATGAAGGTGTTCTCACCTGACGGTCGCATTTACCAAATGGAG
TATGCCTTCAAGGCAATCTCACAGTTCGGTCAGACTTCAATCGCAGTGAGAGGCAAGGAC
TCCGTAGTAGTCTGCACTCAAAAGAAGATCCCAGATAAGCTCATCGTTCCAGATTCAGTG
AGCAACATCTTCAACATAAGCGACAGCAGAGGAGTGATTATTGTGGGAAACATGAACGAT
GCTCGTTTCATCGTTACTTGGTTGAGAAACACTGCTGCTCAATTCAAGTTCAAGAATGCT
TACGAGATTCCAGTCCACGTACTTGCTCAGAAACTCGGTCACTATTTACAGAAGTTTTCA
CAGCACGCTGGAATCAGACCATTCTGCGTCAATGTCACTATTGTTGGTATGGATGAGGAG
TTCGGTGCTCAAGTCTATCGTGTTGATCCATCAGGTCAAGCTGTTGGTTTCAGAAGCATC
TCAACTGGATCTAAAGAGCAGGAAGCTATGACCCAGCTTGAAAAGCACTGGAAAAAGAAT
GAAGGCAACTGGGACAAGAAGGAGACCATTGAGACTGCTATCCAAGTATTGCAGACTGTA
ATTTCAGCTGACTTCAAGGCAAACGAAATCGAGATCGGTATTGCCTCACACGATGATGTG
AGATTCAGAAAATTGACTGAGCAAGAAATTGAAAGCTACCTCAATGACCTCGCTGACAAG
TAATGA


>Contig17068.0.g82(protein)
MSFEKLMKVFSPDGRIYQMEYAFKAISQFGQTSIAVRGKDSVVVCTQKKIPDKLIVPDSV
SNIFNISDSRGVIIVGNMNDARFIVTWLRNTAAQFKFKNAYEIPVHVLAQKLGHYLQKFS
QHAGIRPFCVNVTIVGMDEEFGAQVYRVDPSGQAVGFRSISTGSKEQEAMTQLEKHWKKN
EGNWDKKETIETAIQVLQTVISADFKANEIEIGIASHDDVRFRKLTEQEIESYLNDLADK
Q