Identifiers and Description

Gene Model Identifier

Contig16975.0.1.g31

Standard Name

None

Aliases

Contig16975_0_1_g31

Description

NF-X1 type zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003174002.0004037638327014e-151SAC3/GANP family protein
SGDYNL023C9.003043785111664e-83FAP1 SGDID:S000004968, Chr XIV
from 591160-588263, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16975.0.1.g31(coding)
ATGACTAATCACAGCAATAAGATCAGAGACCACAACAAAGCAGCAACTCAAATCGAGGAC
GAGGAAGAGGTAGCAGAGGAGGCTATAGACAGCCTTACACTGATGTAAATAGTCAGTAAA
CTGATTAGTCAAACCAGAACCAACAGCAAGAAGGTCTTCTTAAGATCAAACACCACAAGA
CTCTTAAAAAGATTCAGAGGAGGAAGAGGAAGTAACAACTACAGAGGAAGAGGTGGCCAA
GGCCGAGGAAACAGTAGAGGTGGCTATTAACAAACAGATTACAATGCAGATTAACAAGTT
GCTACTGATGCTCATTCTCAACCGCAGTAATAGGATGAACAATCCACATATAGAGGTGGC
AGAGGTAACTAAAGAGGAAATAGAGGCAGTAGAGGAGGATACAGAGGTAACAGAGGTGGT
TATCAGCAACAAAACAATCAATATGATTAAGATCATCAACAAGAAAGTTCAGTTAATTCT
CAGTAAGATGATAAAAATACCTCACAGCAATAACAACCATCTAGAGGAGGTAGAGGTGGC
AATAGAGAAAGCGCCAGAGGAAATCGAGGTGGTAGAGGATAAAGAGGCGGCTACCAAGGT
GGTCAAATTAGAGATTCTGATTACTTTGAAGACCGTAAATATGAAAGAGACCAATTTGAA
GGTGGAATGGGTTCCTACTCTAATTCAAACGCATCCAGCATCATGTAACAACATGGTGGT
GATGCAAAGGATAGACTGTGGAGTAAAAAGATGGACACTCAATCCAAGGCAAAACACCAA
ATGGGCAAGAATCTAGGCTCTGCTTCCCAGTATTTGGCTTCAAGTGGAGGCGATGGAGAT
GCTAGAAACCAATACTTGCCCACTAAAAATGAGAAGATTGGCTACATTAATGATGAAGAT
GAAAAACGAGAGATGGAAGCTAAGGAAAAAGCTCAGATAAATTACAACTACCAAGATTTT
CTAAACCAATTCGAAAATCTTACTGAACAGTGCACTTACTTTGTTGAGAGTATGTCAAAA
GGTACATAAGAATGTATAATTTGTCACAATCCAATTTTCCAAAGAAGTGCAGTGTGGAAT
TGCGACTAATGCCATTAACCACATCATTTGGGTTGTATCAAGAGATGGATCAAGAAAATA
AATAATGTAGATGATGATCAAGAAGAAGTTAAGGTTGCACCAGGCCAGTAAAACAGAAGA
GGTTAGCTTGAGTAAAGGGATGATTACGATTCAGAAGAAGAAAAGCAATACGAGAGTGAG
GCTAAAAAAGCAGCTAAGAAATTACTCGCATTCTACAGTTGGACTTGCCCTAACTGTAAC
TTTGCCTATGCAGAGAATAATATGCCCAGATATTTGTGTTTCTGTGGTAGATATGATGAG
CCTCCTTACTCACCACTTATCTTACCACATTCTTGTGGTGAGTACTGTGATAGAAAGCGC
AATGATATCTGTACACATGGCAGATGCGATGTTTTATGCCATCCAGGAAGCTGTCCTCCT
TGTGGTATTTAAGTACCTATCAAATGTTTTTGCGGTAAAGATACAAAGAGAGTTCCTTGT
TAACTATCTCAGAGAAGCTTGTATAGTTGCTAGTAAGAATGCGGTAGATTACTTAATTGC
TAAATTCACGAATGTCAAGATGAATGCCATCAGGGCCAGTGCAAGAAATGTGACATAGAT
ATTTAACAAAAATGCTTCTGTGGAAAAGAAGAAAGGACTGTTAAATGTGGAACTAAGGTA
TTTTTATGTCAGAAAATATGTGGAAAATAACTTGATTGTGGAAATCATAGCTGCCAAAAA
GTTTGTCATGATGGTCCATGCCAGCCTTGTTAAAAAGTACCATCCAAAGTTAAGTTTTGT
CCTTGTGGCAGAAAAGAAATAACTACCTTGATAAATACAAAAAGAAATTCATGCTTAGAT
CCTATTCCATGCTGTCAGGGTAAATGCGAGAAATTCCTTCCTTGTGGCAAACATTAATGT
ACTTTAACTTGCCACAACGACGATTGCATGAAGTGTGAAGAGTTAGTGGAACAGATTTGT
TTATGTGGAAAAGAAAAAAGAAAATTAAAATGCTATCAACTTAACTATCCAGAACATTTA
AGATAAGAATATATGACCCAAGAGGAAATAGATGATATAGACTTTTTCAAGTGCAAGAGA
ATTTGCAATTAACTTTAATCTTGCAAAAAGCATAAATGTCGAGATTTATGCTGCCCTGTT
AAAAAAGGTTAGGATCCTTATGGTAAACATCTGTGCCTGAAGACTTGTAACAAGACTCTT
TCTTGTGGAAAGCATTAATGTAATGGTTTCTGCCATTTAGGACTTTGCAAGCCATGCAGG
TATGTTTCAACTCAGCCACTACCATGCCCTTGTGGTTCTATTAAAATTGATCCTCCCATT
AAATGTGGAACATAGCAACCAACCTGTAATAACAATTGTGGTAAACCTTTGCCATGTGGT
CATAAATGTAATGTTAAATGTCATTTGGGTAATTGTCCACCTTGCCTAGAAATTGTAACT
AAAGTTTGCAATTGTGGAAAAGAGATCATGCCAAATGTATTCTGCAACTAATAAAAGCAT
TCTTGTGGAGCAATGTGCAAAATTGAATTACCATGTGGTCATAATTGCCAAAAGGTTTGC
CATTTAAGAGGTAGCTGTTTCAAGTCACTTGAAGATATAATGCAGAATGGATGTGGTGAA
GCATGTGGAAAGCAAAGAACTTTATGCAAGCATAGATGCCTTGAATCATGCCATCCAAAT
ATGGAGTGCCCAGAAAATCCTTGTGATGCAGAAATCCGTGTCTATTGTAAATGTGGATAC
CGCTTTGTAAATACTCTCTGTAAGTCTATGCCAGAACGTGATCCAATAGAATGCAGTTCT
GAATGCTGGAAACATCAAAGAGAAAAGAAACTAGCAATGGCCTTTGCTGGAGGAAAGAGT
GATTTTGAATAAAATAGAGACATTAACCTAGAATATTATCCAGAAGAAGTGCTTGAATTC
GCCCAATAGTATCCTAAATTCGTAAAGAAATGTGAAACATAACTAACTGACATTGTGCTT
GAAAAGAGTGTAAGAAGTTTCAGCGGGTTAGGTACTGGGAAAAAGAGTTTCTTAACAACT
CTAGTTTTCGAACACTTTAAGTTGGACATGTGCACCTACGGAGGTAAAAACTAAAAGACT
GTGACTGACGTTTTCTGGAAAGAGGGTTGTAAAGTTCCAGATATGATGGTCACTGATATC
ATTTAATTAATTGAAAAGGGCATTTTGTCATCGAATAATGACGACAACAGAAACTAGATA
TTCGAGGCTACTCTCTACATTTTCAATGTGTAGAAAGGTACAACGATTGATGATTTAAAG
AAATTCATGTCCAATTTTAAAAATGAGATGTACACTTAAAAAGGAAAGCAGCAAGGAAGC
TACTACATTCATTTCTACAGAAAAATGCGTGCAAAAGATGCCTTGACTTACATTAAGAAT
TCTCCAAACTAATTCACTAATGTTGAGTTAATCATGCATATGAAAGAAATCGGTACCATT
GAATTGACTCCAGCTTAGCAAGAGAGTGCAATTGAGAAGAAGAAAGCAGCTCAAAGGCAA
TAAGTAATTGACGATGATGGATTCATGACAGTCGTTAAGAAGAAATGA


>Contig16975.0.1.g31(protein)
MTNHSNKIRDHNKAATQIEDEEEVAEEAIDSLTLMQIVSKLISQTRTNSKKVFLRSNTTR
LLKRFRGGRGSNNYRGRGGQGRGNSRGGYQQTDYNADQQVATDAHSQPQQQDEQSTYRGG
RGNQRGNRGSRGGYRGNRGGYQQQNNQYDQDHQQESSVNSQQDDKNTSQQQQPSRGGRGG
NRESARGNRGGRGQRGGYQGGQIRDSDYFEDRKYERDQFEGGMGSYSNSNASSIMQQHGG
DAKDRLWSKKMDTQSKAKHQMGKNLGSASQYLASSGGDGDARNQYLPTKNEKIGYINDED
EKREMEAKEKAQINYNYQDFLNQFENLTEQCTYFVESMSKGTQECIICHNPIFQRSAVWN
CDQCHQPHHLGCIKRWIKKINNVDDDQEEVKVAPGQQNRRGQLEQRDDYDSEEEKQYESE
AKKAAKKLLAFYSWTCPNCNFAYAENNMPRYLCFCGRYDEPPYSPLILPHSCGEYCDRKR
NDICTHGRCDVLCHPGSCPPCGIQVPIKCFCGKDTKRVPCQLSQRSLYSCQQECGRLLNC
QIHECQDECHQGQCKKCDIDIQQKCFCGKEERTVKCGTKVFLCQKICGKQLDCGNHSCQK
VCHDGPCQPCQKVPSKVKFCPCGRKEITTLINTKRNSCLDPIPCCQGKCEKFLPCGKHQC
TLTCHNDDCMKCEELVEQICLCGKEKRKLKCYQLNYPEHLRQEYMTQEEIDDIDFFKCKR
ICNQLQSCKKHKCRDLCCPVKKGQDPYGKHLCLKTCNKTLSCGKHQCNGFCHLGLCKPCR
YVSTQPLPCPCGSIKIDPPIKCGTQQPTCNNNCGKPLPCGHKCNVKCHLGNCPPCLEIVT
KVCNCGKEIMPNVFCNQQKHSCGAMCKIELPCGHNCQKVCHLRGSCFKSLEDIMQNGCGE
ACGKQRTLCKHRCLESCHPNMECPENPCDAEIRVYCKCGYRFVNTLCKSMPERDPIECSS
ECWKHQREKKLAMAFAGGKSDFEQNRDINLEYYPEEVLEFAQQYPKFVKKCETQLTDIVL
EKSVRSFSGLGTGKKSFLTTLVFEHFKLDMCTYGGKNQKTVTDVFWKEGCKVPDMMVTDI
IQLIEKGILSSNNDDNRNQIFEATLYIFNVQKGTTIDDLKKFMSNFKNEMYTQKGKQQGS
YYIHFYRKMRAKDALTYIKNSPNQFTNVELIMHMKEIGTIELTPAQQESAIEKKKAAQRQ
QVIDDDGFMTVVKKK