Identifiers and Description

Gene Model Identifier

Contig16954.0.g31

Standard Name

None

Aliases

Contig16954_0_g31

Description

Bucentaur or craniofacial development

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam07572 ) Bucentaur or craniofacial development
  • ( pfam12722 ) High-temperature-induced dauer-formation protein
  • ( pfam09531 ) Nucleoporin protein Ndc1-Nup

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001364500.000009002574193719714hypothetical protein
SGDYBR231C0.00020003864201578029SWC5 SGDID:S000000435, Chr II
from 683090-682179, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16954.0.g31(coding)
ATGGACAACCTTTTGCACGCTAAGTTTGATTCTGATGAGGAAGATGATGACTACATCCCA
GATGAAGATAAAGAAGATAAAAAGAACAAGAATAAAAATGGGAAGAATGATGACTACGAT
TCAGATAAGGAACTTACTGGAGTAGCTGGCTTAAAAGCTCAAAAGAGAAAGAAAGAAATA
GATGACTTATGGGCCATGATGAACGAGGAAGATGACTATTATAAATCTAAATCTAAATAG
CAGAAAACACAGGAGAAATAAGTAATTGCCCCAGCTATTACACAAAAACAATCAAATACT
AGTAATAACACTACTAATAGTATTTAAAAATAATCCGCCAATTAATTACCAACAAATAAA
AAAGTAGAATAAATCAATTCAATAAGCATTAATTAAGATGAAGAGTAGAAATAATTGAAT
CAGTAAGCTGAAAAGCCTCAGGACGAGGCATTCAATGCAGCTCTTGAAGCTATCAGACAA
ATGAAATAAAAACAGAGAGACTTATTGGTTCAAGATAAAGTGCGGTATGCAGGCCAAACT
TACCAAGTTGAACGCAATGCAACTTAAAAAGACTTGAAATAAAGAGAAATACAAGACAAG
AAGAAACTAGGAGGCACTTGTGGAGCTCTAGATGATTTAGTGGGTCTTATTAACGATTAA
GGAAAGAATGTGAATGTGGTCGAGAAGTCTAAAATGGATTGGAGCAAGTACACAAAAGAA
GAAAAGTTAGAGGCTGAGTTTGAGAAGAACAGGAAGGATGGATATTTGGCTAAGAAAAAA
TTCTTGGATTAGGTAACTGAGACTGAATATGAATACAAGAAGCAAATTGAAAAAGCTACT
CTTTAGCAAAGGAAATGA


>Contig16954.0.g31(protein)
MDNLLHAKFDSDEEDDDYIPDEDKEDKKNKNKNGKNDDYDSDKELTGVAGLKAQKRKKEI
DDLWAMMNEEDDYYKSKSKQQKTQEKQVIAPAITQKQSNTSNNTTNSIQKQSANQLPTNK
KVEQINSISINQDEEQKQLNQQAEKPQDEAFNAALEAIRQMKQKQRDLLVQDKVRYAGQT
YQVERNATQKDLKQREIQDKKKLGGTCGALDDLVGLINDQGKNVNVVEKSKMDWSKYTKE
EKLEAEFEKNRKDGYLAKKKFLDQVTETEYEYKKQIEKATLQQRK