Identifiers and Description

Gene Model Identifier

Contig16948.0.0.g28

Standard Name

None

Aliases

Contig16948_0_0_g28

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004871509.997093137033517e-262hypothetical protein
SGDYLR429W0.0000020007268868677913CRN1 SGDID:S000004421, Chr XII
from 990777-992732, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16948.0.0.g28(coding)
ATGCCTCTCAAAGCGCCACTAAAGGTTGGAAAAAAGAAGGTAAAGCAGGCTGATAAGAAA
AAGAGAGCCATCGTTGAAGAGCAAGAGAGCGAAAATTTGGAGGATGATGCTGATCTCCTC
AATATGGATCAGAATAATCAATTAGGTGGCATTGATTAAGAGCAACTGACAGCTGAAGAG
AAGGAGGATCAAGTTATTAAGACTTTGAATTCTAATAATCCTCAGGCTCCACACAACCTC
ACTAAATTTTCTTACAAGGATCGTTTGTTCAAGACAGACGATATGGTTGAGCAGATGGTC
TTCCATTTCTAATTCGATGGAGATATTATTCTCAAGGATAGTGATGAGGCTCATGACTAG
GAGGAGTTCTGGGATAATAAAAAGAGAACCAATTAAGGTCTTCTAGATAAAATCAATGTT
GCTATCAAGGAAGAATTTGGCAAGGATCCATTGGAGGGTAACGAGAAAGCTTAAAAGAAG
TCTTTAAGAAATCAGTTTAACTTCCAAGAGAGAGCTGCACAAACTTTCAATCTTCCACTA
AGAGAGAAAGGTATCAAGACTGATCCTCCCCAATGCTCAGTTTTCTCTCTTGAGACAACT
CAATGGATGATCTTCGATGCTTACATGTAAGCTTGGGAAGATATGCAAAGAGCTGAACTA
GAAGAACAAATGAAAGGTAAAGCTAAGGACAAGAAGCCAGTCCAATAATAGTAATAACAC
GTTGAGGACCCACTTTACAGCACTTCAATGAAGAGAGCTCTTAAAATTATGGAAAGAATG
ATCGTTCAAAATGCTGATGAAGAGAAATTCGAAGATTACAAGTATTACGAAGACACAACA
GAGGACCCCGAGAGCCATAACTATGGTTCAGTTTTGCCTCTATGGCGTTTCTCTACTGAA
AAGAGTAGAAGAAAGCATGTTACTTCCATTTGCTGGAATCCAAGATACAAGGATCTCTTT
GCAGTTGGATATGGTTCATATGATTTCTTGAAATAAAACACTGGTTTAATCTGCTGTTAC
ACAATTAAGAACCCAACATGGCCAGAGTATTCCTACACAACTGAGTCAGGAGTAATGTGC
CTAGACTACCATCCTAAATATCCAGCATTACTCGCTGTAGGTTGCTATGATGGTACAGTT
ATGGTATTTGATATCAGACTAAAGGGAAACAACAAGCCAATCTATCAGTCAACTGTAAGA
ACAAACAAGCACACTGACCCAGTCTGGCAAGTGAGATGGTAAGCTGAAGACGCTTCTAAG
CAACTCAGTTTCTACTCAATATCTTCAGATGGTAGAGTTACCAGCTGGAACTTGATGAAG
AACAAGCTCGAGCCTGAGGAAGTTATCAAGCTCAAGTTGGTCATTGATTAAGATAAGGAA
CTAGTTGAGAACAAGAAGGAGGCTTTCCTCTATGGACTTGCTGGTGGTATGTGCTTCGAT
TTCAACAAATTCCAAGACCACCTCTTCTTAGTTGGTACTGAAGAAGGTAAAATTCATTTA
TGCTCAAAGGCATACTCTGGTCAATACTTAGAGACTTACGAAGGTCATTACTTAGCTGTC
TACGCTGTAAAATGGAACCACTATCATCCTAGAGTTTTCATTTCATGTTCTGCAGATTGG
ACAATTAAAATGTGGGACCAAAATATTATGAGACCAATTATGACATTCGATTTAGGATGC
GCAGTTGGTGATATCGAATGGGCCCCCTACTCTTCAACTGTATTCGCTGCTGTTACTTCA
GCTGGTAATCTGTACGTGTATGACTTAAAACAAGAAAAGCATCACCATTTATGCGAGCAC
CCTGCCATGAAGAAGGCTAAGGCACTCCATGTGTCCTTCAACTGGGAAGACCCAATCATC
TTAGTCGGTGACGAGAGAGGTGGAGTCAATTCATTCAAGCTGAGCAAATCACTCACCAAG
GGACCAATGCAACCAACTAAGGAAGACGACAAATCTACTCCACAACAATTGGAAATGAGA
AAGATGGAAGATTTCTTAAACAATCAAGATAAAGAAGTATACTGA


>Contig16948.0.0.g28(protein)
MPLKAPLKVGKKKVKQADKKKRAIVEEQESENLEDDADLLNMDQNNQLGGIDQEQLTAEE
KEDQVIKTLNSNNPQAPHNLTKFSYKDRLFKTDDMVEQMVFHFQFDGDIILKDSDEAHDQ
EEFWDNKKRTNQGLLDKINVAIKEEFGKDPLEGNEKAQKKSLRNQFNFQERAAQTFNLPL
REKGIKTDPPQCSVFSLETTQWMIFDAYMQAWEDMQRAELEEQMKGKAKDKKPVQQQQQH
VEDPLYSTSMKRALKIMERMIVQNADEEKFEDYKYYEDTTEDPESHNYGSVLPLWRFSTE
KSRRKHVTSICWNPRYKDLFAVGYGSYDFLKQNTGLICCYTIKNPTWPEYSYTTESGVMC
LDYHPKYPALLAVGCYDGTVMVFDIRLKGNNKPIYQSTVRTNKHTDPVWQVRWQAEDASK
QLSFYSISSDGRVTSWNLMKNKLEPEEVIKLKLVIDQDKELVENKKEAFLYGLAGGMCFD
FNKFQDHLFLVGTEEGKIHLCSKAYSGQYLETYEGHYLAVYAVKWNHYHPRVFISCSADW
TIKMWDQNIMRPIMTFDLGCAVGDIEWAPYSSTVFAAVTSAGNLYVYDLKQEKHHHLCEH
PAMKKAKALHVSFNWEDPIILVGDERGGVNSFKLSKSLTKGPMQPTKEDDKSTPQQLEMR
KMEDFLNNQDKEVY