Identifiers and Description

Gene Model Identifier

Contig16750.0.g70

Standard Name

None

Aliases

Contig16750_0_g70

Description

IBR domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005373408.99586662241984e-56IBR domain containing protein
SGDYKR017C0.000000000000020000882446601127YKR017C SGDID:S000001725, Chr
XI from 473349-471694, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16750.0.g70(coding)
ATGAACGAACAAAAGAGACAAAGACTAGGAATGTACCTAAATGTCATTAATTAATCTAAG
GCAAAGTTAGATTATTAAGACTGCTTCATGCTTGGAATAGCTTTCTCTAATTTTACAAAG
AATGGTGAGGATTTAGAAGATGTTGTGACAAGTATCCAAGAAAACAAAAAGAGTTTGAGA
GGAGTTGCACTAAACGACAACTAAAAGTTAGATAACCGCATCAAATTTCTTGAAGATATT
CAAGATGGCATTCCAGCTCAGTTACTTAATCAGTAAAAGCCTAAGCCACACAATGGAAAT
GCCTAAACTCTGAACAGTAATCTAAAAAAACGAAGCTATGAGGAAACTGGTTTAAAGAAA
TCAGAGGATGAAATTAAGATTTTGGCTGAAAATGATTTCCATTCATAAAATGGAAAGCGT
AAAGTCATTCAGATATCTGAGATTGAGTTCTAAAGCGACGAGGAAGAAGGTAGGAGCGTG
CCTATTCAAAGGAAACTAGATAATATCCCTTCTTTCACAGATGATTCTTTATCTAATAGT
GTTTTCAAGAAGAACAGCTTCGACAAAAAGAGCAGTGCAAACTCAGCCAGTGTCTCAGGA
AATGGTCTTGGATTTATCAACAATGAAAAGATTTCAGACTTAAACTAAGCAATCGACAGT
TTAGACAATACTCAGTTTAGAGGGAGTATCAAAGCTGGATCTAAATCTGCAGGTTCTCAC
AACGATCTCTCTTAAGAACTACCATTAAACACTAATCTTTAGGATAACTCCTAGAAGGTT
TATTCATCAATGAGTCAAAACGTTGATGTATAGATGCTTCAAGAAAAAGAATAGGGTTTT
GATATAAGTCCCAATGATCAAAATGGAGGTCAAATTCACAAAGAATTTAGTTTCAATCAT
TTGAGAGGCTCATCTACTGGAATAGCTTTTGCTGAGTCAATCGAAATGATTGATACCAGC
ACTAATAGAAATAAAAACTAGTACTATAATTAATTGGACAACAAAAATAAGCAAGCTAAT
TAGTTTGTAGTTGATGATGATGATCTTCTCGAACTTTTAGAGGAAGAAAAAGGGCTTAAT
TTTGGTATATAAAATAACTTTGAAATTCAGGGATCAATTGATCCTCTGACTAAGGATTTG
ATTCTAAAACTTCAAGAGGAGGAAGAATAGGAACGTAATAATCTTCTTAAACAGAAAGAT
GAGCACATTGATGAGAACTTCAAATGTCCAGTATGCTTTGACGGATATGACGAAGAGAAC
ATCTTGCCACTAACTAGCTGCGATCATGTCTTCCACAGAGAATGCCTCCAGATCTATTTG
AATGGTGAAATTTAAGAAAGTAAGTTCCCTCTGAAGTGTCCCGAAAACGCCTGTCAGAAA
GAATTGTTGATCGAAGATCTCAATGATATACTTTCGGAAGAGCAAAGACAAAAGCATTTG
GAGTTTACATTCAATCAAGCAATCGCACAATAACAGGACATGATGTGGTGCCCCACTGCG
GACTGTAAGAATGTACTTGTTATCGAAGAAGGTGTTAATGAACTTCATTGTGACTAATGC
AATAAAGACTACTGTGGATAATGTAAGGTGGAGTATCATAAAGAGAGAACATGTGCTTAA
TTCTAAGCAGAAAACTAAAACGACAAGGAATTCTTGGAATTTGTCAAAGGCAAATAATTC
AAACAATGCCCCTTCTGTTAATTTTGGGTTGAGAAATCGGAAGGGTGTGACCATATGACT
TGCAAGTGCAAGAAGGAGTTCTGCTATAAATGCGGTGGCGTGTATCGTGCTTGCGAATGC
ACTAAGGAAGCGTAGAGATAAGAAGAGCTTAGAAGATAGAGAGTCATAGAAGCCAGGAGA
CAAGCTACTTTGAGGAGATAGGAAAGAGTTAAGAGATAAAAAGAGAAGGAAAAAGAGAAG
CAATTATTGCTTAAATAGAGAGAAAAGGAGAGGTACGAGTTGTACGAGAAACTGCAATAG
AATGGCGAAATACCTCAGGGTAGACACACCAGAAGTACCATAAAGGCAGTGCTTGAAATC
ATAGAAAAAGATAAGATAAATCGAAAGGGTGTGACATATGACTTGCAAGTGCAGAAGAGT
CTGCTATAAATGCGGTGGCGTGTATCGTGCTGCGAATGCACTAAGGAAGCGTAGAGATAA
GAAGAGCTTAGAAGATAGAGAGTCATAGAAGCCAGGAGACAAGCTACTTTGAGGAGATAG
GAAAGAGTTAAGAGATAAAAAGAGAAGGAAAAAGAGAAGCAATTATTGCTTAAATAGAGA
GAAAAGGAGAGGTACGAGTTGTACGAGAAACTGCAATAGAATGGCGAAATACCTCAGGGT
AGACACACCAGAAGTACCATAAAGGCAGTGCTTGAAATCATAGAAAAAGATAAGATGTTG
CCTATTAAGAGAGGAAATAGATAATGA


>Contig16750.0.g70(protein)
MNEQKRQRLGMYLNVINQSKAKLDYQDCFMLGIAFSNFTKNGEDLEDVVTSIQENKKSLR
GVALNDNQKLDNRIKFLEDIQDGIPAQLLNQQKPKPHNGNAQTLNSNLKKRSYEETGLKK
SEDEIKILAENDFHSQNGKRKVIQISEIEFQSDEEEGRSVPIQRKLDNIPSFTDDSLSNS
VFKKNSFDKKSSANSASVSGNGLGFINNEKISDLNQAIDSLDNTQFRGSIKAGSKSAGSH
NDLSQELPLNTNLQDNSQKVYSSMSQNVDVQMLQEKEQGFDISPNDQNGGQIHKEFSFNH
LRGSSTGIAFAESIEMIDTSTNRNKNQYYNQLDNKNKQANQFVVDDDDLLELLEEEKGLN
FGIQNNFEIQGSIDPLTKDLILKLQEEEEQERNNLLKQKDEHIDENFKCPVCFDGYDEEN
ILPLTSCDHVFHRECLQIYLNGEIQESKFPLKCPENACQKELLIEDLNDILSEEQRQKHL
EFTFNQAIAQQQDMMWCPTADCKNVLVIEEGVNELHCDQCNKDYCGQCKVEYHKERTCAQ
FQAENQNDKEFLEFVKGKQFKQCPFCQFWVEKSEGCDHMTCKCKKEFCYKCGGVYRACEC
TKEAQRQEELRRQRVIEARRQATLRRQERVKRQKEKEKEKQLLLKQREKERYELYEKLQQ
NGEIPQGRHTRSTIKAVLEIIEKDKINRKGVTYDLQVQKSLLQMRWRVSCCECTKEAQRQ
EELRRQRVIEARRQATLRRQERVKRQKEKEKEKQLLLKQREKERYELYEKLQQNGEIPQG
RHTRSTIKAVLEIIEKDKMLPIKRGNRQ