Identifiers and Description

Gene Model Identifier

Contig16690.0.g70

Standard Name

None

Aliases

Contig16690_0_g70

Description

Roadblock/LC7 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001520408.001486403440551e-25Dynein light chain 2B, cytopla
smic, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16690.0.g70(coding)
ATGGCAGAAGTCGAAGAGAGAATCGCTCGTATTAAAAATCACAAGGGTGTCAAAGGTCTT
TTGATCGTCGATGAAAATGGTAAATTCTTGAGATCTACCATGTCATCCTCAGGCAACGAC
ACTGCTCCAAAGCAGTATGCTCAAAAAGTAACTGAACTCGCAAAGAAAGCCAGATCAGTC
GTGAGAGACATTGATCCACTCAATGACTTGACTTTCTTCAGAGTTAGATCAAAGAGACAA
GAGATCATGGTTGCCCCAGACAAGAACCTCTTTTTGATTGTAATCTAACAGCCATCAGAA
GACAACGAATGA


>Contig16690.0.g70(protein)
MAEVEERIARIKNHKGVKGLLIVDENGKFLRSTMSSSGNDTAPKQYAQKVTELAKKARSV
VRDIDPLNDLTFFRVRSKRQEIMVAPDKNLFLIVIQQPSEDNE