Identifiers and Description

Gene Model Identifier

Contig16644.0.g57

Standard Name

None

Aliases

Contig16644_0_g57

Description

KOW motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003823508.996537154595168e-51hypothetical protein
SGDYLR344W6.999359373303508e-39RPL26A SGDID:S000004336, Chr X
II from 819312-819330,819...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16644.0.g57(coding)
ATGAAGACCCACACTTCTGTCTCAAGCCAGAGAAGAAAGTCCAGAAAGGCTCACTTTAGC
GCTCCTTCAAGCATCAGAAGAAAGCTCATGAGCAGCCATTTGAATAAGGAGTTGAGAACC
AAGTACGACGTGCGCTCAGTCCCCGTCCGCAAGGGTGATGTCGTAAAAGTCATGAGAGGT
GCCTTCAAGGGTAGAGAGGGCAAGGTTATCACCGTCTACAGAAAGAAATGGGCTGTACAC
ATCGAAAAACTCACCAGAGAAAAGACCAACGGAACCCAAGTTCAAATCCCACTCGCTGCC
TCAAACCTCCTCATCACCTCCCTTAAGATTGACAAGAACAGAAAGGAGATCTTGGAAAGA
AAGAAGAGAGTCACCAAGGAGAAGAACAAGCACAAGGAGGGTCTCGCCGGTCTCGACTGA


>Contig16644.0.g57(protein)
MKTHTSVSSQRRKSRKAHFSAPSSIRRKLMSSHLNKELRTKYDVRSVPVRKGDVVKVMRG
AFKGREGKVITVYRKKWAVHIEKLTREKTNGTQVQIPLAASNLLITSLKIDKNRKEILER
KKRVTKEKNKHKEGLAGLD