Identifiers and Description

Gene Model Identifier

Contig16339.0.g84

Standard Name

ANP32f

Aliases

Contig16339_0_g84

Description

Leucine Rich repeats (2 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010792000.00000000000004998767099442072Core histone H2A/H2B/H3/H4 fam
ily protein
SGDYPL169C0.0000007997233352734267MEX67 SGDID:S000006090, Chr XV
I from 230838-229039, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16339.0.g84(coding)
ATGGGAAAAATGGCTAAGCTTATGACTAATGAAGAAGTCATGCAAGGCGAGGATTAACCT
ATGATTTTAGAGAGAACCATACTTTAGAGAGTACCAGAGGGCAAGAAAATAAAAGTTCAT
GAATATGAAAGTTTGCTCTTGGATGGTGTGGCAACACCTAAAATGTTCCCAAAAGACAGA
GTATTTCTTGAGAGATTTGTGAATGTCATGGTCCTGGGCTTCAATTCTTGCAGCATTAGG
ACACTATCTAAATTTCCTATGATGGTGAAAGTTGTTAAACTAGAACTGTAAGACAATAAA
ATCAAAGCTGGCTTAGAGAAAATAATTAAAAAGTTCCCAAATTTGGAGATTTTGAAGCTT
GGCAATAATTATATTGATACTTTAGCAGAAGTGAAGAAACTCAGCAAACATAAAACATTG
AGGAGTGTGGAGTTATATGGTAATCCGATTTGCGAAATTCTCAATTATACTGAGAAAATA
CTAAATATATTGCCTGATATAATGGTTCTTGATGGCTAAGACAGAGACGGTAATGAAGTT
GTTACTGATGAAGAAGATGTTAGGAATGATGACGATTCTTGTGATGACTATGGTGATGAG
CAAGATATGATAGCTGATGGTGTGATTTAAGAGGAAAATGACAAGATAAGCAGTGGAGGT
AGTGGAATAGGCGAAGATGAGGAAGAAGAAAAGAAAGAAGGTGAATAAGATGAGGATGAT
GAATATGAAGAGCAAAAAAGCAGTGAGGAGTCTGATCCTGGTGAAGAAAGCAGCAGTTCT
GATGACAGCACAGACTCAAAGTCTAACAATAAGCATATTAAACAGTAAACCAATAAAAGT
AGCAACAAAAACACAAAAACTAAGTCAGCCAAGTCTTCATCATCCAACTCTGAATCATCC
TCTTAAAGTTCAAATTCCTCCAATTCCTCAAATAGTTCCTCTTCTAGCAATAGCAGTTAA
GAGGGCAAAAACAGGAAGTTATCAAACAGTTAAAAATAGAGGTTAGAATAACAGCACAAG
TTGACTATGAAAAAGCTCAAAATGCTTGAGTATTCTTCTGGAAGTGATTGTGATGACATG
TCCAGGATGAATTTTGGAGATGGGATGTTTAAGGATGAAAGCAGTTCAATTATTAATCTG
GGCAAGAGAAAAGCAAAGGCAATTAGGAATAGTATCTATGAAGGAAGTGCTATTGAAAAA
CGCATTTGCATTAATTGA


>Contig16339.0.g84(protein)
MGKMAKLMTNEEVMQGEDQPMILERTILQRVPEGKKIKVHEYESLLLDGVATPKMFPKDR
VFLERFVNVMVLGFNSCSIRTLSKFPMMVKVVKLELQDNKIKAGLEKIIKKFPNLEILKL
GNNYIDTLAEVKKLSKHKTLRSVELYGNPICEILNYTEKILNILPDIMVLDGQDRDGNEV
VTDEEDVRNDDDSCDDYGDEQDMIADGVIQEENDKISSGGSGIGEDEEEEKKEGEQDEDD
EYEEQKSSEESDPGEESSSSDDSTDSKSNNKHIKQQTNKSSNKNTKTKSAKSSSSNSESS
SQSSNSSNSSNSSSSSNSSQEGKNRKLSNSQKQRLEQQHKLTMKKLKMLEYSSGSDCDDM
SRMNFGDGMFKDESSSIINLGKRKAKAIRNSIYEGSAIEKRICIN