Identifiers and Description

Gene Model Identifier

Contig16327.0.g53

Standard Name

None

Aliases

Contig16327_0_g53

Description

Cyclin, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001920009.003144504923815e-42Cyclin, N-terminal domain cont
aining protein
SGDYNL025C0.0000000010002658722841845SSN8 SGDID:S000004970, Chr XIV
from 585291-584320, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16327.0.g53(coding)
ATGGAGAATATACCAGAAGTATATAAGACGAACTTAGAGCGTGAATTCGAAGCTGCAAGA
GAACAGGACCTCTAAGTAGTCCAAGAAGATGCTAATGACATCCCACTAACACTCTAAGAA
AAGGTCTTAAGTTTAGAACCCTCCGAGCGAGTACTCACTGTCAAAAACTACTTAGATTAC
ATATGCGATAGCTTTGATATTAACAATTAATCAGAAAATTCCACAAATGACAGTACAGAT
GAGGGAGCTATTGCTATAAATCTACCCATTAATACAGTCACCCCGAGTGAACTAGAAGGT
TTAAGTCTAGAGGATGAACGTAAATTCAGAATATATGGCTGCATGCTTATATAAGAAGCA
GGAATTTTACTAAAATTACCAATGATTACAATGGCTACAGCATAAGCTATATTGCATAGA
TTTTACTATAGAAAGTCGTTCATGAAATGCGAGATCCTAACAGTTGCTACAGCTTCGTTA
TTCTTGGCTGCTAAAATCGAAGAAAATCCTCGTAAATTGAAAGATGTAATTTCAGTTTTT
GACTATGTCTATAAGCTTAATAAAGCTAACAATTAAAGACCAGTTCCTCTACTAGATATA
AGTTCCTTTTAATTCACAGATCTCAAGAGCGAAATTGTTGATGCTGAGAGATTCATTTTG
AAAGAGTTGGGCTTTTCAACATATCAATTGAGTACTTTGAACGTTCACAAATTTATTTAC
TTCTACTTGAGAGTTCTGGATGGTACAAAACAACTTGCTCAGAAAGCTTGGAACTACGTT
AATGATGCTTATAAGACGACCGTAGTAGTGTGTTTCCCACCTAATGTTGTTGCATGCAGT
GCCATTTACTTGGCATCTAAAATCATGAATTATCCATTTCCAAAGGGTATTGAGTGGTGG
AAGATATTTGGAGTGAAGTTTGAGGATATAGAGTATGTATCAGCTTCCATTTTAGAACTG
TACAAAATATGTAGCACCAGTGATAATCAATAATTGTCAATTACTGCTTAATATGTAGAA
GGTGTAGTTAAAGGTGTGTTAGAATAACAAAAAGCAGCTAAAGAATAGCATATTAAGAAA
CTTAAAGAAGAGGGTAAATTTGATAAGTAAACTAAATGGGCGCCACCTGTCAGTGGTTCA
GGTTAAGAATAGTAAGATACTCATGATTAAGAAATGAAGGAAGAAGATATTAACTAGCTA
AATAAAAATGCTGTTGATAGAAATTAACCAGCAATAAAAGACATCAAAGAAGATTCAAGA
GATCTCCATAGAAAGAATGACAAAGATTAAAGACCAGTAGTTGATAGGTCATCTAGAGAT
AGAAGAAGAGATGATAGTTATGACAGAAGAAGACATAGAGACTATGATAGAGATAGGCAC
CATAGAGACAGAGATCGTGATTATAAAGATCGCGACTACAAGGATCGTGAAGATAGACAT
AAAAGTAACAAACATCATAAACATAAAAGTTCAAAGAGGCACAGAAGAGACTATAGTGAT
GATAGCGAAAGAGATCGCAGAAGAAATAAATCAACAAGCAGAGATAGAAAGAGAAAAGAT
CATAAAAAAGAGAGTCGCAGATCAAGATCTAAAGGTAGAAAAGATGAGAGGAAACCTGAT
GCGAAAAGAAAAGATTCAAGAAGTCCAAATTCAGATAGAAGTAGCAGTCTTGACAGTAGA
TGA


>Contig16327.0.g53(protein)
MENIPEVYKTNLEREFEAAREQDLQVVQEDANDIPLTLQEKVLSLEPSERVLTVKNYLDY
ICDSFDINNQSENSTNDSTDEGAIAINLPINTVTPSELEGLSLEDERKFRIYGCMLIQEA
GILLKLPMITMATAQAILHRFYYRKSFMKCEILTVATASLFLAAKIEENPRKLKDVISVF
DYVYKLNKANNQRPVPLLDISSFQFTDLKSEIVDAERFILKELGFSTYQLSTLNVHKFIY
FYLRVLDGTKQLAQKAWNYVNDAYKTTVVVCFPPNVVACSAIYLASKIMNYPFPKGIEWW
KIFGVKFEDIEYVSASILELYKICSTSDNQQLSITAQYVEGVVKGVLEQQKAAKEQHIKK
LKEEGKFDKQTKWAPPVSGSGQEQQDTHDQEMKEEDINQLNKNAVDRNQPAIKDIKEDSR
DLHRKNDKDQRPVVDRSSRDRRRDDSYDRRRHRDYDRDRHHRDRDRDYKDRDYKDREDRH
KSNKHHKHKSSKRHRRDYSDDSERDRRRNKSTSRDRKRKDHKKESRRSRSKGRKDERKPD
AKRKDSRSPNSDRSSSLDSR