Identifiers and Description

Gene Model Identifier

Contig16290.0.g21

Standard Name

None

Aliases

Contig16290_0_g21

Description

Domain of Unknown Function (DUF1042)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009392301.000499495426459e-47hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16290.0.g21(coding)
ATGGAAATCCCTGCGCTTGATGAAGAAGAAATGCAAATTATCTATAATTGGGTTGATGAG
ATTCCACTCTCAAGACCTAAGCGCAACATCGCTAGAGATTTTTCAGATGCTGTACTGGTT
GCTGAAGTAGTGAAACATTTCTTACCGCATCTAGTAGAAATACACAATTACAGTGCAGCT
CATTCAGTGAGTTAAAAAACTTACAATTGGAACACTTTAAATCAGAAAGTCTTCAAGAAG
TTAGGTTTCACTTTGACTAAAAAGGATATCGATGACTCTGTAAATTGTGTGCCAGACATC
GTTGAGAGAATACTCATGGTTTTACAAAATCATGTAAGTTATTAGCATTTTTATCAATTC
AAATTTAGATCAAACTTTATCAAGAGAAAAGGCAAGGCAAAATGGGCATTAATGGAGGTA
AGAATCGATTTATGTCTCTATAACTTTGAATTTGACATAGGAAGCGCAGATTTGATAAAT
GACTTCAATTCAGGCATGAACTTTGGTGGTCCAAGCAGCTAATAATAACAAATGCAGCAT
AATTTCATGAATAACAAAGAGAACAACAAATTCATGGCTCCAGGGTTCAATCAATAACAA
CAATAATATCCAATGACTGCTGGAGCTATGGGCCAGCCTGACCCTAGACAATAATAAAAA
CAAATGATGCTCCAGAACTAAGTAGACAATGAAATTCTCATGGAAAAAGAGCAAACTATT
GTGCAAATGAAGGAAACAATTGAAATATTAGAACTTAAGATTAAGAAATTAGAGTAATTA
GTCAAGCTAAAAGATGCTAAAATTTCAAATTTGTCAAATAAACTACAAACTGCTGGTATC
ATTCCTTGA


>Contig16290.0.g21(protein)
MEIPALDEEEMQIIYNWVDEIPLSRPKRNIARDFSDAVLVAEVVKHFLPHLVEIHNYSAA
HSVSQKTYNWNTLNQKVFKKLGFTLTKKDIDDSVNCVPDIVERILMVLQNHVSYQHFYQF
KFRSNFIKRKGKAKWALMEVRIDLCLYNFEFDIGSADLINDFNSGMNFGGPSSQQQQMQH
NFMNNKENNKFMAPGFNQQQQQYPMTAGAMGQPDPRQQQKQMMLQNQVDNEILMEKEQTI
VQMKETIEILELKIKKLEQLVKLKDAKISNLSNKLQTAGIIP