Identifiers and Description

Gene Model Identifier

Contig16260.0.g37

Standard Name

None

Aliases

Contig16260_0_g37

Description

Chromatin associated protein KTI12

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_014449105.001369568193564e-73KTI12 protein, putative
SGDYKL110C3.001290106883431e-24KTI12 SGDID:S000001593, Chr XI
from 229880-228939, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16260.0.g37(coding)
ATGGTTGGAATTCCTTGCTCAGGTAAGACTACTAGAGCAAATTAAATAGCTAAATATGTC
CAAGAAGTATTGGGATTAGAAGTGCAAGTTATAAATGAAGAATTACTAGGATTAAATAAA
CTAGAATACTATTGTGACCCTACTCAAGAGAAAATTCTTAGAGGCTCTCTCAGATCAAAT
GTTGAAAAGTTTTTAGATTCAAAGCGTGTAGTCATCTTAGACTCAATGAACTATATTAAG
GGTTTTAGATATGAACTTTACTGCTTGGCTAGAAATGCAATGACAAACTTAATGATTGTT
TTTTGTGATACAGAGAGGGAAATAGCTGAAAAATTATGCGACGAGGGAGCTTATGAAAAT
GCATTTCCAAAGGAACTGTTTACTGATTATGCAGGAAGGTTGGAGCGACCTATTCCCTCA
AATAGATGGGATAGTCCACTGTTCCATCTGAGATTTGATGAGGAAACTCCAGTTGAAGAT
ATAGCCAAAGTAATAGTAGATGGGAAAAAGCCAAGAGATCCTGTTTCTACTAAGCCAGAT
CACATGTTTGATACAAATTTTATATATGAACTTGATAAAGCCTGCTAAGATGTAATAAAT
TACATAATTCAGAAACAGTCTGAATACAACCCTGGTGACTTTATCGCCCTTAACTATAAA
TACTATAAAATGATGAGAATTATATCGCCAGTTGAGATTAAAAAGTTTAAGAAAGACTTT
TTAAATTTGAGCAAGTTACACCCTCCTAAAAGCAAGGACAAATTTGGTGATGCTTTTTTG
GAATTCATTAATGGATAAATAACAGATTGA


>Contig16260.0.g37(protein)
MVGIPCSGKTTRANQIAKYVQEVLGLEVQVINEELLGLNKLEYYCDPTQEKILRGSLRSN
VEKFLDSKRVVILDSMNYIKGFRYELYCLARNAMTNLMIVFCDTEREIAEKLCDEGAYEN
AFPKELFTDYAGRLERPIPSNRWDSPLFHLRFDEETPVEDIAKVIVDGKKPRDPVSTKPD
HMFDTNFIYELDKACQDVINYIIQKQSEYNPGDFIALNYKYYKMMRIISPVEIKKFKKDF
LNLSKLHPPKSKDKFGDAFLEFINGQITD