Identifiers and Description

Gene Model Identifier

Contig16185.0.g84

Standard Name

None

Aliases

Contig16185_0_g84

Description

ER lumen protein retaining receptor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009976202.0008113830639685e-30hypothetical protein
SGDYBL040C0.0000000020002373268528243ERD2 SGDID:S000000136, Chr II
from 142749-142112,142868...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16185.0.g84(coding)
ATGGCAAAAAGTTTAGACCTATAACTTTACTTATTTGTGGCTGGTTACCTTGTGGAGCAC
ATTGGTAATGCAATTATGATATATAAGCTACATAAGCAGAAGACAATGTATGGTGTATCA
ATAGACACTCAGATCTGCCTGATGTTTGCAGCAGTCGCCAGAGTATTTTGGATGTGGGAC
ACTTAGCTTACCAAGCTGACCATCTCCATGATTGAAATCATCATGGCAGTAGCAATGCAC
GCCTACATTATCTTCCTGTGCTACCAGTTCAAAGATACTATCTACAAGGGAGTCAAGGAG
AAGTTCCTAAAGAGCCCTGTTCTCATTGGCATATGTTTAGTTTTATCTCTGATCTTTCAT
CCTGGAACTAAAGGCGAGTTTTTCTTTACTCTGTAGATGCTAGTATCTTTCACTATATTC
CTTGAGGCACTAGCTCTTCTTCCTTAACTACAGCATTTGAGATAAAATCGCGATCCTGAA
GGATTAACTTCGAATTATTTGTACTGCTTGGGAGGTTCTCGTGGAGTAAGATTCTTCTTC
TGGGTGGCGATGATCACAAATAACGATAGTTTCTGGTATTTGATTGTGGCTGACCTCGTG
CACACTGGCTTACTAATTGGCTTTTTCTATCTGTACAGGCAAACACTCAAGCAAGGCGGA
GGACCCATTTTAGCATTCACTGATAAGAAAATGTATTGA


>Contig16185.0.g84(protein)
MAKSLDLQLYLFVAGYLVEHIGNAIMIYKLHKQKTMYGVSIDTQICLMFAAVARVFWMWD
TQLTKLTISMIEIIMAVAMHAYIIFLCYQFKDTIYKGVKEKFLKSPVLIGICLVLSLIFH
PGTKGEFFFTLQMLVSFTIFLEALALLPQLQHLRQNRDPEGLTSNYLYCLGGSRGVRFFF
WVAMITNNDSFWYLIVADLVHTGLLIGFFYLYRQTLKQGGGPILAFTDKKMY