Identifiers and Description

Gene Model Identifier

Contig16139.0.g36

Standard Name

None

Aliases

Contig16139_0_g36

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00176 ) SNF2 family N-terminal domain
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam00385 ) Chromo (CHRromatin Organisation MOdifier) domain
  • ( pfam13401 ) AAA domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000493101.999787596754473e-118SNF2 family N-terminal domain
containing protein
SGDYBR245C2.9996277075259347e-88ISW1 SGDID:S000000449, Chr II
from 711539-708150, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16139.0.g36(coding)
ATGAGATAGATATCTTAAGCTATTGAAATTAACGAAAAAATAAAGCAAATAATTTAGAAA
GATGAGCCATTTCAATATGTTTGCAATGTATGTTTAGACTCCAGGAAATTAGACTAAATT
TGTGATATAATTGATACCACTAAACTAAGTCCTTAAATACTTTCAGAAGAGATTGATTTT
ATTAAAACTTACTGTCTTGTAAAACTCATGCATGCAAGTTACATTCATGCAGTGTGGATA
CCATTTGTTATTGCTGAGGATCTTTCAAAACCTAAATGTCTTGGGTTCATAAAAAAGAAT
GAGCTTTATACATACCAAGATATTATAAATTACCATGAGACGAAGACATCCAATGACTAT
GGAGACAATTTTCATAATATTCTTATTCCAAGCTTACAACCAGAAAGAATTTTAGATTAG
TACAAAAAAGGTCAATACTTTCTTGTAAAATGGAAATAGATTGATCATAATGGGTTGACT
TGGGAAAATTTAGAGTTTATTGATAAATACTATCCATATTTAAAGCTTGAATATTTCAGA
ATGCTTTAGAGTCAAACTTTAATAAACCTGAATTCAGCAATTGGAGCTTAATATAGAATG
GAATTGATTAGGAAAAGAGACTTGACACCTAATTTAGTTCCAATTATGTAATATTAGGGG
ACACCAGAGTTTATAAACATGAAGCATGATTAAATGAAGTTACATGAGTATCAAGTAGAA
GGATTAAATTGGATGATATATTCATGGTTCAATCGTACAAATGTAATCTTAGCAGATGAA
ATGGGTCTGGGAAAAACAGTTTAAGCAATTGCATTTATCAGCTATCTATTAAATGTTTAA
TAGATATCAAGACCTATGCTTATAATTGCCCCACTTTCCACAATTGATAATTGGAATAGA
GAATTTAGTCTTTGGTGTCCAGAAGCTAAGGTTTTAATGTACAATTCTGAATAAAAAGCC
AGATAAATCGCTAAGAATTATGAATTTTTCTATGAAATGTAAGATAAACCAAATTTACCT
TATATGAAGAAAATAAGAATTCCAAAATTCAATGTGATTTTAACAACATATCATTTCATT
CAAAGTGACTATAAGAATTTTGTCTCGATTGATTGGAGAGCCATAATAATAGATGAAGGG
CAGAGATTAAAATCAAATGAGTCAAAGCTATTCAGACTTGCTTCAACTCTTTAAACAGAG
TGGAGATTACTCTTGTCCGGTACTCCTTTGCAAAATAATATTGGTGAGTTATTCAATTTA
CTTGAATATCTTGATCCTTCAAAATTTAACCAGAAGTTCAGAGATGATTTTTAGAAGAAG
AATTCTTCGTCTATCTTTATCCAGGATTAGAAATAATCAATTGTTACTCAAAAGGATGTA
AATTATACAGAAACCAAACAGATTACTTAATCTTTATAGGATAAATTAAGTGATAGCACA
AACGATAAAACTCAGAGTTCTATCTTATAATAGAGTAACCCAGAGAGTCCTAGAACCTAG
AGAGAAGACGATCTAAATATAGAATAGGAGCAAGGAGCGCTAATTCAACTATAATAAATC
CTTAAACCACATATATTAAGGAGATTTAAAAGGGATGTATTCAAAACTTTCCCAAAAAAG
AAAGAAGTTATTATAAGAGTTGAGATGACTCCAAGATAGAAATATATATCAAAATGCATT
TTATAAAAGAATATGGAATAGCTGTCTTAATTTGAAAAATCTAAATCTAGTGCTAAAGTC
TCAATGAAGTCTGTTATGAATATCTTGACTCTTTTGAGAATGGTCGCAAATCACCCTTTA
CATTTAACTGAACAATATGCAACAGAACATTATAGGCAAACTCAGCTATATGATAAAAAT
AAAGTTAATCAAGATGAGTAGCCCTAGCTTCATTCACTTTAAGATTTTCTGAAAGATTCC
GCTAAACTTTTGCATTTTGATAAAATGCTAGACATTTTAATTGAGTAAGGACATAGAACT
TTAGTATTTTCTTAATTTATGGGAACACTTGATATCCTCCAAGACTACTTACAGGCAAAA
TAAATATAATCTTTAAGACTAGATGGAAGTACAAGTAATTCTAAAAGGTAACGACTAATC
GATTTGTTTAATCAAGAAAAGTCACCAATAAAAGTATTTTTACTTTCCACTAAAGCAGGA
GGGCTAGGTATAAACTTGACTTCAGCAGATACAATATTTATTTACGATTCAGATTTTAAC
CCTCACAACGATATTTAGGCTTTAAACAGAGCACATAGGATTGGGCAGAAAAACAATGTC
ATGATCTATAGATTCGCTTGCAAAAATTCAGTTGAAGAGCGCATGTTAGAAATGGCTAAA
CATAAACTTATGCTTGATACTGTGATGGTTCATGGATAGAAGAAAAACAAGGATAACAAT
TAAAATGGAAAGGAAAACAGAGACTTATACTAGATTTTAAGGTTTGGTACAAAAAAGCTA
TTTGAAAATGACGACTAAGATAATCAAAATGAAAAGTTTAGCTTTAATGATTAATTATAT
GAAATAGACCTGGAATAGCTTCAGGTAGTGCTTGACAGAGAAAAGTAATTCAAGGATTTA
GAAGAGGAAGAAAAATTAATGGAAAATAATGATGATGGAGTTAGGGACTATTTAAGTGGT
TTTAAAGTCGCTAACTTGGAATAGAAAATATAGAAGACAACTGAGAACCAATTAAAGTAT
ACAGATCTAATGGATCTAGATCTCGAGGGCTACGAAGAAGATGATAAAAATGATAATATT
TTCTAAAAGCTTAGTAGTAAATACTGCACATCATAATAAGCCCAAAATACTTAGCCATAA
ATTGAGCAATAAGATAACCATGAATAAAAAGCAAAAGCAGATTAAAGCTTAACTTAACAA
TAAGATAATGAAAAAGATAATTAATTCAAGGGCATTCGAACTAGAAATAAAGCGAAAGGC
ATTACTTATTAATCACCAGCTAAAAAAGAAAAACAACTTGTTTTATAACCAAAGATTGAT
TAAAGGGTGTCGTTCATCAAATAAGGAGGTTTTTAAAATTACAATGAATCTAACTGA


>Contig16139.0.g36(protein)
MRQISQAIEINEKIKQIIQKDEPFQYVCNVCLDSRKLDQICDIIDTTKLSPQILSEEIDF
IKTYCLVKLMHASYIHAVWIPFVIAEDLSKPKCLGFIKKNELYTYQDIINYHETKTSNDY
GDNFHNILIPSLQPERILDQYKKGQYFLVKWKQIDHNGLTWENLEFIDKYYPYLKLEYFR
MLQSQTLINLNSAIGAQYRMELIRKRDLTPNLVPIMQYQGTPEFINMKHDQMKLHEYQVE
GLNWMIYSWFNRTNVILADEMGLGKTVQAIAFISYLLNVQQISRPMLIIAPLSTIDNWNR
EFSLWCPEAKVLMYNSEQKARQIAKNYEFFYEMQDKPNLPYMKKIRIPKFNVILTTYHFI
QSDYKNFVSIDWRAIIIDEGQRLKSNESKLFRLASTLQTEWRLLLSGTPLQNNIGELFNL
LEYLDPSKFNQKFRDDFQKKNSSSIFIQDQKQSIVTQKDVNYTETKQITQSLQDKLSDST
NDKTQSSILQQSNPESPRTQREDDLNIEQEQGALIQLQQILKPHILRRFKRDVFKTFPKK
KEVIIRVEMTPRQKYISKCILQKNMEQLSQFEKSKSSAKVSMKSVMNILTLLRMVANHPL
HLTEQYATEHYRQTQLYDKNKVNQDEQPQLHSLQDFLKDSAKLLHFDKMLDILIEQGHRT
LVFSQFMGTLDILQDYLQAKQIQSLRLDGSTSNSKRQRLIDLFNQEKSPIKVFLLSTKAG
GLGINLTSADTIFIYDSDFNPHNDIQALNRAHRIGQKNNVMIYRFACKNSVEERMLEMAK
HKLMLDTVMVHGQKKNKDNNQNGKENRDLYQILRFGTKKLFENDDQDNQNEKFSFNDQLY
EIDLEQLQVVLDREKQFKDLEEEEKLMENNDDGVRDYLSGFKVANLEQKIQKTTENQLKY
TDLMDLDLEGYEEDDKNDNIFQKLSSKYCTSQQAQNTQPQIEQQDNHEQKAKADQSLTQQ
QDNEKDNQFKGIRTRNKAKGITYQSPAKKEKQLVLQPKIDQRVSFIKQGGFQNYNESN