Identifiers and Description

Gene Model Identifier

Contig16126.0.g91

Standard Name

None

Aliases

Contig16126_0_g91

Description

PCI domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004460901.9994050701445255e-104PCI domain containing protein
SGDYER021W2.0002571866765887e-62RPN3 SGDID:S000000823, Chr V f
rom 196948-198519, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16126.0.g91(coding)
ATGAGTGAAAATCAAAAGAAGGACGTTGAAATGAAGGAAGTCATTGATACTTCCACTACA
GACAAGAAAACTGAAGAGCCAAAAGCCCCAGAAGTAGTTGATCCTTTCTTTGAGTTCAAG
AAGGTCATGGTCCTGTTGGAGAAAGCAGCAAAAGATAAGGATTATAAGCTTGCAGCTTCA
TTAACCAAATAATTTAAGAAGCTAAGAAAGCTACTTAATCTCTCCGATGCTGTCCTAATT
CTCTCACACTATATCCCAGATCTATATCAGAGATTACAATTGCCCTGTCAACCCACACCA
ATCACTGAATCAGCAGAAACCAAGCTTTAATGCACAAGTGTTAGAGCAACTGAGATAATG
CAACATGCTGAGACATAATTGTTCCTCTACAATATCCTCTTAATGAAGCTTATAGATGAT
GGTGATCTTAAGAATGCTAAGGAATTTGGAGACTTCGTGTACATGAGATTGAAGAATGTT
AGCCTTAGAACCTTAGATCATTTAGCTGCTAAATCACTTTATCTCTATTCAGTAGTTTAT
GAGAAACAAAGACTTCTTCATTAAATTAGACCAGTCATGTTTGAGGCTTACAAAACTGCT
TGCTTGAGATAAGATCAAATTGGTCAAGCTACAATTACCAACATCATTTTGAGATCATAC
CTACATCAGAACTTGTATGAATAAGCAAGAAACTTCATTGTTAAGACTTCCTTCCCCGAG
TCTGTTTCAAACAATCAGACATCAAGATATCTCTACTATCTTGGAAGAATTAAGGCTGTT
TAACTTGAATATTCTGAGGCTCAAGCAAGACTTATTCAAGCTTTAAGAAAGGGTCCAGAA
GTTGGAGCTCTAGGTTTCAGAGTTCAAGTTCAGAAGCTTCAAATCATAACAGAATTATTG
ATGGGAGAAATTCCAAACAGGCAAATCTTTTCTCACCATGATTTCAAGAAGCATCTTGCT
CCATACTATTAAGTTGTAACATCTGTCAAGTCAGGAGATATGATTACTTTCAAAAAAATC
TTACAAACTCATCACGTACTTTTTGAGAAAGATAAGAACTTGACTTTGATCCAAAGATTG
AGACACACTGTTATTAAGTTTGGTCTTAAAAAGATAAACATCAGTTATTCCAAGATCTCT
ATGAAGGACATCGCAGCAAAGCTAAGTCTAGAAAGTATCGATGAAACTGAGCAAGTAGTT
GCTAAGGCCATTAGAGATGGAGTCATCGATGCAGTAATTGATCATGATAACATGTGGATG
AGATCTCAAGATATCACTGATGTTTACACATCCAATGATCCACAGACAATTCTTCACAAG
AGAATTAAGTTCTGCATGGATCTTCACAATGATGCACTCAAGGCACTTGAATTCCCACCC
AAGGAAGATAAGAGAGATTTTGGAGATTTGGATGAAGAGAGAAGTACTAAGGAGGAAGAT
ATTCTTGCAACTCTTCTTGAAGATATGGGCATGGATGATATGTGA


>Contig16126.0.g91(protein)
MSENQKKDVEMKEVIDTSTTDKKTEEPKAPEVVDPFFEFKKVMVLLEKAAKDKDYKLAAS
LTKQFKKLRKLLNLSDAVLILSHYIPDLYQRLQLPCQPTPITESAETKLQCTSVRATEIM
QHAETQLFLYNILLMKLIDDGDLKNAKEFGDFVYMRLKNVSLRTLDHLAAKSLYLYSVVY
EKQRLLHQIRPVMFEAYKTACLRQDQIGQATITNIILRSYLHQNLYEQARNFIVKTSFPE
SVSNNQTSRYLYYLGRIKAVQLEYSEAQARLIQALRKGPEVGALGFRVQVQKLQIITELL
MGEIPNRQIFSHHDFKKHLAPYYQVVTSVKSGDMITFKKILQTHHVLFEKDKNLTLIQRL
RHTVIKFGLKKINISYSKISMKDIAAKLSLESIDETEQVVAKAIRDGVIDAVIDHDNMWM
RSQDITDVYTSNDPQTILHKRIKFCMDLHNDALKALEFPPKEDKRDFGDLDEERSTKEED
ILATLLEDMGMDDM