Identifiers and Description

Gene Model Identifier

Contig16083.0.g101

Standard Name

None

Aliases

Contig16083_0_g101

Description

Touch receptor neuron protein Mec-17

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam05301 ) Touch receptor neuron protein Mec-17

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003557801.9990449803848145e-49conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16083.0.g101(coding)
ATGGAGTTTCCGTTTAACTGTGAAAAAGTGCTCGGTGTTGACGCCGAAGGTTTCGCTATC
TTAGATGGTAGAAAAGGAGCAAGCTAGATGCAGTAGTAAAACAAGGTAATATAAAGATAG
TTGCCAGAATTGCAAAGCCATCTACACGATATTATCGATAAAATGGGACATGCATCAACT
AAAGCTTAAGGACTGCCAGCAGTTATAACTACTGCAGGCCGTTTGTTTACAAGTGATAAT
CGTTTATATCTAAGAGCAGAGGGCAATAAAGTTATTGGATTACTTAAAGTAGGAGTCAAA
AAACTATTTATAAGAAATGAAATGGGGGCCATTAAGGAAATTTCTCCAATGTGCGTACTT
GATTTCTATGTTCATGAAAGTGTACAGAGAGGTGGTCAAGGAAAAGCACTTTTTGAAAAA
ATGCTTGAGAATGAAGGGGTAAAACCTGAAAGTCTGGGATATGACAAACCTTCTGAGAAA
CTATTAGGTTTTCTTGCTAAGCATTATGGCTTGAAGCGATATGTACCATAGAACAATAAC
TATGTTGTATTTAGTGCTTACTTTGAATAATAGTCTAATGTGAGAGGAGGAGTTTAGAGT
TCAATCGACAATCAAAAACAAATTCAATAATAAACTACCAATTCTTTCTTTAATGGGTTT
GGTTCATAATAAGATTAGAGAAGAAATCAGTAATAAAACACATCACCATATGCTTAGACA
ATGTATAATCCAAAAACAAACAATAATCAGTCCAATCCAAACTTGCAATCATAAACTAAA
CAAGAGAGCTAAATTACAAATAACATCTTTGGAACTACCAATAACTTTTATAGTCATCAA
CAATCCCAAGGAAATAGAATTGGCTAGCATAGCAATTTGCCTCCTAAGCCCTAATAAAAA
TCTGACTAAAGCTCCTTGACAAATGCAGGAGGCCAGCAAATATTTGGGTCAGCTGTTCAA
CAATAAAATAGAACAAATGGTTCTGCTTACTCAGATAAGAGATCATCAACAACTGATAGA
GTCTTTGGAGGAGTTATGACAACTGCAGATTAAGGTTAAAAAGAAAATAACTACAAAAGA
AACTAAAATAATATATAGCTTCCACCATCTTCAAATTCTTAAAGCAGAAGAGGAGGTTAA
TTAGATTCAGTAAGCTCCCTAATGCAAGATATGTAATCAATGGGCTTAAATGACAATCAA
TTGCCTAAAAATCAGTCACATATAAAGAACGGTCAAGATTATCAATTAAGCAAGGTAAAT
TCACGTCTAAGTGACAACGAACTTATACTAAAGAAGACTTAAGAAGAAATGTTGTAGCTA
ATGATGAAAAGCAATTATAACTAAACCAACTCAGGTGGCTTTGGTAACTAAAGTAATTCT
AAAAACACCGTATTATTACAAAGACCAGTTTCTGGAAAATCCTAGCAGTCAATTGTGGCT
CCTTATGTTTATATTCCAGAAAACAGTAACCCTGATTAAACAAAGAACTAATAAGGTCCA
ACTTCCTTCACTGCTGCTGGAGGGGACTATATGAAAAGAACTCAGTTTGCTACATTGAAT
GATGATATTACTTAGAGATTAAATGACAATTAGAAGTTTGTCTAACTATAGAAAGAAATA
AATAATGGAGCAAGAATTCCTTGGGCATCATACAACTACTAAAATTCGCACTACAAAAGA
TGA


>Contig16083.0.g101(protein)
MEFPFNCEKVLGVDAEGFAILDGRKGASQMQQQNKVIQRQLPELQSHLHDIIDKMGHAST
KAQGLPAVITTAGRLFTSDNRLYLRAEGNKVIGLLKVGVKKLFIRNEMGAIKEISPMCVL
DFYVHESVQRGGQGKALFEKMLENEGVKPESLGYDKPSEKLLGFLAKHYGLKRYVPQNNN
YVVFSAYFEQQSNVRGGVQSSIDNQKQIQQQTTNSFFNGFGSQQDQRRNQQQNTSPYAQT
MYNPKTNNNQSNPNLQSQTKQESQITNNIFGTTNNFYSHQQSQGNRIGQHSNLPPKPQQK
SDQSSLTNAGGQQIFGSAVQQQNRTNGSAYSDKRSSTTDRVFGGVMTTADQGQKENNYKR
NQNNIQLPPSSNSQSRRGGQLDSVSSLMQDMQSMGLNDNQLPKNQSHIKNGQDYQLSKVN
SRLSDNELILKKTQEEMLQLMMKSNYNQTNSGGFGNQSNSKNTVLLQRPVSGKSQQSIVA
PYVYIPENSNPDQTKNQQGPTSFTAAGGDYMKRTQFATLNDDITQRLNDNQKFVQLQKEI
NNGARIPWASYNYQNSHYKR