Identifiers and Description

Gene Model Identifier

Contig16064.0.g67

Standard Name

None

Aliases

Contig16064_0_g67

Description

T-complex protein 10 C-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam07202 ) T-complex protein 10 C-terminus

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003822201.9993430003514377e-39T-complex protein 10 C-terminu
s containing pr...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16064.0.g67(coding)
ATGTATAACTAAAGATCGCCTCATTCATTAGGGCCGTAAATGAAAAATTCCAGTCAAACA
AATAGATTCAGTGACTACAGTCCCATTACTAGTACAAATTCAAATGCAACAGCCAATGTG
ACTAGCAAGTATAATTTCGATTATGCTGCTGGCAATGCTAATGGAGGATAAAATCAAATT
GAATAGATGCAGTTGCTTAGCGACTAACAGCAGATGAAACTTCAGCCATCTTCTTAACAA
CAGTAATACATTGGAAATAGATTTGCAGATCAAGCTTAACCATTGCAAATCCAGAACCAA
AACAGATTGAGAGATGCAATGAGCAGTGAAAACTTGAGAGTTCAGAGACATCCCGGTTTA
TTACAACAGTAAAAGGATATGAGTGGACTCACTGGAGGGGTATTTCAACACCAATAACAG
ACAAACCAACTATAAGCCAATGTAAATCCTTCAGGATTAGGGTCAGTCAGTGGATTCTCA
ACTTTGGCTTAGGCGCAATCCACAAGTTAACAATAGCAGACACCCATTAATTTGTAAAAT
CTAGCAAACCCTAACATCCAAAATATTCTTCAACAACTTCAATAGAATCAGAGTCTTTAA
CAGCAATAAAGTGTTCCTTCTTAATTGTCTGATTAAGCCCAAGGAAATCCATAAATTATG
CAGATGTTAATGTAGCAATAATAACTTTAGTTAATGCAATCTTTGTTAGCCTAATCGACA
TAAATCTAAAGTAATGTCCAGAGACAGCCATAAAACCCAAATTAATCTCTTGACATAAGC
AAGTTAGTTTTGAATTAGCAATAACAGCAGCCTTAACTCATAAACAATCAATAACTTCAA
CTATAACAACTGTAACAGCAGTTTTTGGCTTAACAACAATAACAATAGCAGCAGCAGTAG
TAGCAACAAAACCCTCTAACTCAACAATTACTTCTTCAACAGCTACTAGCCCAATAATAA
CAGCAGACATCGATGCAATTACCAAATACTACATCTAACACACCATCTGGTTAGAATTCT
TTAGCTTAAGCTTTAATGTTGCTCTAACAGTAAAGCTTTTAAGCCTAAAAAAACCAAAAC
CCCTTATCTCAAATTTAGCAAAGTGAAATCAATACTAATTTAACCACTCCAATGGACACC
AGTAGACTCATAAATCAGTCAGCTAACTTCAGCGGTGCTCTACCCTAGAGTAATATGACA
GGAGGCTCATCACAGCATCAACAATTTGTCTAGAACTATCAGCAAATAAATGAAACTTTG
AACTAATACAGAAAGATTGCGACCTTCATCGGCTAATAAGAAGGACAGCAGAAGCAGTAG
TAGTAGCTCTAATAATAGTAACAACAATAATTGAAGAATTCATAAATCTCCTAGGCTAAA
CCTCAACAAATGAGCTAAATGCAGCAGTAACCCAACTTAATGCAAAACTATCACACATAG
AATGAACAAATAAACTAGAGTGTGATGCTGGATTAGTCTCGATATATGTAATCTGATATC
GCGAATGAATAAGAGAAATAGAGACCAGCTTCGAGCATGGATGTCTCCTAAACTTAATAA
AAGGCAATGTTTGAAAGTTAGAAGCAGAGCATTGATCCAAATGCTGCAGTCTCCTGGCCT
TCTCAAAATAATCATTCTGACATCATTTCAAATCATGAAAAGAGTTTTGCATCTCCGCAA
AGCCAAGGAAATTAAAGTAGTAATTAAATACCTTTCCATAAAAAGTCTTAAAATAATAAT
GACTTCGTGAGTTCATAACATACAAGTGCTACACCTCATTCATAGTCTCAATAAGTTCAT
TAGAATTAGTAAAACTTATCAGATCAGGAGTATTTGAGATAAATTGATAAAACAAGTCAG
AATCAATCTGTGATATAGCATTAATAATCTTATGTCTCTGAACTTGAATATGAGACCAAA
TTTATTGAAGGTGACTATGATGGAAAGAGTAGCTAGATACTGTAAAACATGGGCAATTTA
AGTGGCTAAGATTTAAGAAACGATGCATCTTTCAATCAAATAAATTAAGCAAACAATTTG
CTTTAATTGCAGTTTTTGAACTAGCAGTAGTAACTCCTGAACTAAAACCTCTTAACTACT
CAAAACTAGCAATTCTAAGAGAGATTTTCACATCATTCGAATTCACACTTATCAGAGAGT
GGATTTCACGACTAGAGTATTCATCACGAAGAAGGAGCTTCACTGGCAAATCAAAGTCAT
CTCTCAGCCAGTGGCAGGACAGCAGCACACGATTACATGAATCAGTCACTCGGCCAGGTT
GACCCATCTCAACTCAGATCAGTCGAGAAGAGCAGCAATTAAGGGTTTGATGAGTAGGAA
AATCACTAAGTCAAAGACAGAGAGGAAAAGCCCATTTCACAACATAAAATGACATTTGAA
GAGTTACTGGAGAGTAAACTTTAGTAGGAAGATGGCTTTGTTGCTGATAACCAAAACAAC
TATCATAGTAACAATAAAGTTGTAGCTTCTGGATAAAAAAGGGAATATTTAAGAAGAAAC
TCAAATAATAAGCAAGCTTTAGAATAGTCTAAATCAGCTTAAAAGCAATATAAATACTAT
GCTGATAACTTTGCCAACCAACAAAACACTCTATCAATAAGCAAATCTCCTAGAGGTTAA
TCCGCAAACCCCATCTCCTCAAACGACAATTCAACCTATAAAAAATCCTCAACTTAGAAC
TAAACTTCAAAGAGCAACCAGAAACAACCTCAAAGCAGACAGTAGTAGCACTCCAATTAG
AAATCCTCTCCCAATGCTAGCCAGACCAATAGACCACATTCTTAGTAGCAATTGCATGAA
CCAAAATTCAAAAATTCTATTGAGAATCAACCATTAAGAACCACAGTAGCTGCAAAATCT
AGATAGTAATAAGTGAATGGTGGATTGAACTTGAATTAGAGTGAAGACGTTGTTAATTAA
GCAAGAATTTTGAATAATTAATAAAATCAGCACGTCAATGATACCTCAATGATATCAATT
TCTTAAAACTCTGTATCATTCTCTCAGACTAACAAGAGCAACAAGAAGTCTACAGCAAAG
AAGCAATAATCTAAAAACGAGATCTCGCAGAAAAAAGCCAAAGTTAATCCTTAAATGCTT
AAAAACGATTAGAACATAATGAGTGGTGATATTTTACCATTGAAAATTGATGAACATTAG
ATTCTTCTCTCTGATCGAAATAGCATAGCTGAATTTGAGCAGCTAGAATAAGAATGCATA
GCTAAGTACTTATAAAATTAAAGCATGCAAATTTTCCCTGATACCAATTAACTAGATCAT
ATTGGCTCTCATGATGCTGATTATATGCTCGAGTCCCAATCAGTCCAGTCTCATTCTTAA
TCTCAGACTAAAACTGGAACAAATAAAAAGAAGAAATCTCCTAAGGGTAAATCGAAGAAA
GTTACTCCAATGAAGATTTAAGTGCCAAGTGGAAATGAAGCAGGAAATACTAGAAATACA
GTAACTACTGGTACTTCTTAAACACAACCAATCACTCCTAACAACCAATACGAGGGAGCC
TAATCACTTGAGAATACCATGACTCACCCTCCTCTTTCCACTAATAACTAGGGTAGTTTG
CATGAAACCCCAAAATCCGCTAGAAATCAATCTATAACCAAAGCACTTCACCAACTTGAT
TCCGAGTCCTAAAAAAGGCTAGATCAAAAGATTCAGGAATTAGAATTTGAGATTCAAAGA
TTCAAGCAGGAAAAGCAAAAAGTTTAAAATCTCCAGCAAGAATACGAAGAATAGCTTGAG
AGAGTGACCAGAGAAATTGAAGACTTCGAAAGCCGTAAAGAACTCGAAGTAGAAGAGATT
TAATAATGGAAGGATGAGCAGATGAGAGAAATAGAGTAGGAGAGACTTAAAATTGAGAAT
GAGAAAATGGAGGTAGCTCAGTATAGACAAGAAATATTAAGAGAGAAAGAGAGATACGAA
AGTTAACAATCAGAAGAGAGTGAAAGAGTCAGATATTAGATTTCATGCTTGGAAAGAGAT
AATTACGAGCTGCAAGAAAAGTTGGCTGAATTTACTAACAAAGATCTCTATGAAATAGGC
TTGCAAACTGATGAAATCAAGGTTAATGAGATTGAAGTTAACACTGTAATAACAGGCGAT
ATTTAAATCATAAAGCAGACTTAAACTTAAGCTCTTAGCCCAATTAGAGGCATCCTTAAA
AATTCAACAACCAGCCCTAGACAAGAGGAAGCTAAACTTTTGTAAATCGAGGCATAAACT
TTCGAACATAACATCATTCTGAATGAAGATGAGATTAAACTCAGACTTAAGAACTAATAC
CATCATGATTGTCAAAACGTTTCAATTTAGGTTGAAGAAGAACCAGTTATGAAGCATCAA
TAAGAATTGCAAACAAGCTTCATTTTAGAGTAAAACACAAGGTCTCAGTCACCAATACTT
GAAGATCAAATTGTTTTGCAAGATCAGATAGTGATGAAGACTAATACATAGAGATGCATT
GAGAGTAGTAGCGTTCCAGCAAGTTAATATCAGAAGATGCTGGAGACTCATGATTCACCG
CAATAGGTAGAAGATGAAGAAATTAGGTTGGAAGAGGAAACTCTTAATTAAGATTAAAAT
TAAAACTCAAATACCAAAAGTTAATCAAGTAAATAATCAAACCAATCTTAAGACCACAAA
CAATCACAAGCTCAATAAACTTAACCCATAAAGCATCAGCAATCGTAACCACAAAAGAAT
TTAGATAAAGTTTAGTCTAAACCTCAATAGCAAGTTTATCACGTGTAAAAGAAGCAAGGC
CTTCCATCACAATCCTAAAATAGAGTCCTATCTCCTAATCCTTCTTAATCAGCATTAGCT
TCTCAAAGATCCTCCTCAACTCAACCATAAGCCAATAACACAGTGCAGCAACAGGCAATT
TAATAGTAAAGTTAACTCTAGCAAATACAACCTTAGTTAGTTCAGTAGGTACAGCCAACT
TTGCTATCGTAATTCTCTCAATCTGATAAAGCTAGCAGCAAAAAGGAAGAACATAAGGGC
TTTGAGGATGAAGTAGACGACGATGAGTCAGACGAGGATGAGTTTGATCTAAAGTTCCCA
GCAGAATATCACGGAAAATAACAAAAACCAGAGCAAATGATTGAGGAGATTACTTCTCAC
GATGGTAAAAAGCAGAGATTCTTTGATAACGGAAAGAAAGAGGTCGTCTTCAGTAATGGA
GTGAGGAGAGAAGTATGGCCTTCTGGTTATTCAATAGTTTATTTCAATAACAACGATGTG
AAGCAAACTTTCCCAGATCAGAAGGTAGTCTACTATTTTGCTGAAGCAAAGACTACTCAA
ACCACATTCCCTAATGGCTTGCAAGTGTTTAAATTCTCAAATAATCAAATTGAGAAGCAT
TTCCAGGATGGCACTAAAGAAATATCTTTCCCAGATGGCACCATCAAGTGTCTATTCCCA
GATGGTGAGGAGGAGAGCATTTTCCCTGATGGCACTATTCAAAAGATTGAGAAGAATGGT
GTTAGAATCATAGAATTTCCAAGTGGCTAAAGAGATGTTCTATATCCTGATGGCACAAAG
GTCAGAGAGTTCGAAGATGGCTCAATCAAAAAGATTCACGCAGATGGCAGAGTAGAAATA
ATTTAAGCACAGAAGAAGAAAGGATCAACTACTTAACCCAAAAATCTTAACAAGTATATG
AACTAACCTCGAAAGAAATGA


>Contig16064.0.g67(protein)
MYNQRSPHSLGPQMKNSSQTNRFSDYSPITSTNSNATANVTSKYNFDYAAGNANGGQNQI
EQMQLLSDQQQMKLQPSSQQQQYIGNRFADQAQPLQIQNQNRLRDAMSSENLRVQRHPGL
LQQQKDMSGLTGGVFQHQQQTNQLQANVNPSGLGSVSGFSTLAQAQSTSQQQQTPINLQN
LANPNIQNILQQLQQNQSLQQQQSVPSQLSDQAQGNPQIMQMLMQQQQLQLMQSLLAQST
QIQSNVQRQPQNPNQSLDISKLVLNQQQQQPQLINNQQLQLQQLQQQFLAQQQQQQQQQQ
QQQNPLTQQLLLQQLLAQQQQQTSMQLPNTTSNTPSGQNSLAQALMLLQQQSFQAQKNQN
PLSQIQQSEINTNLTTPMDTSRLINQSANFSGALPQSNMTGGSSQHQQFVQNYQQINETL
NQYRKIATFIGQQEGQQKQQQQLQQQQQQQLKNSQISQAKPQQMSQMQQQPNLMQNYHTQ
NEQINQSVMLDQSRYMQSDIANEQEKQRPASSMDVSQTQQKAMFESQKQSIDPNAAVSWP
SQNNHSDIISNHEKSFASPQSQGNQSSNQIPFHKKSQNNNDFVSSQHTSATPHSQSQQVH
QNQQNLSDQEYLRQIDKTSQNQSVIQHQQSYVSELEYETKFIEGDYDGKSSQILQNMGNL
SGQDLRNDASFNQINQANNLLQLQFLNQQQQLLNQNLLTTQNQQFQERFSHHSNSHLSES
GFHDQSIHHEEGASLANQSHLSASGRTAAHDYMNQSLGQVDPSQLRSVEKSSNQGFDEQE
NHQVKDREEKPISQHKMTFEELLESKLQQEDGFVADNQNNYHSNNKVVASGQKREYLRRN
SNNKQALEQSKSAQKQYKYYADNFANQQNTLSISKSPRGQSANPISSNDNSTYKKSSTQN
QTSKSNQKQPQSRQQQHSNQKSSPNASQTNRPHSQQQLHEPKFKNSIENQPLRTTVAAKS
RQQQVNGGLNLNQSEDVVNQARILNNQQNQHVNDTSMISISQNSVSFSQTNKSNKKSTAK
KQQSKNEISQKKAKVNPQMLKNDQNIMSGDILPLKIDEHQILLSDRNSIAEFEQLEQECI
AKYLQNQSMQIFPDTNQLDHIGSHDADYMLESQSVQSHSQSQTKTGTNKKKKSPKGKSKK
VTPMKIQVPSGNEAGNTRNTVTTGTSQTQPITPNNQYEGAQSLENTMTHPPLSTNNQGSL
HETPKSARNQSITKALHQLDSESQKRLDQKIQELEFEIQRFKQEKQKVQNLQQEYEEQLE
RVTREIEDFESRKELEVEEIQQWKDEQMREIEQERLKIENEKMEVAQYRQEILREKERYE
SQQSEESERVRYQISCLERDNYELQEKLAEFTNKDLYEIGLQTDEIKVNEIEVNTVITGD
IQIIKQTQTQALSPIRGILKNSTTSPRQEEAKLLQIEAQTFEHNIILNEDEIKLRLKNQY
HHDCQNVSIQVEEEPVMKHQQELQTSFILEQNTRSQSPILEDQIVLQDQIVMKTNTQRCI
ESSSVPASQYQKMLETHDSPQQVEDEEIRLEEETLNQDQNQNSNTKSQSSKQSNQSQDHK
QSQAQQTQPIKHQQSQPQKNLDKVQSKPQQQVYHVQKKQGLPSQSQNRVLSPNPSQSALA
SQRSSSTQPQANNTVQQQAIQQQSQLQQIQPQLVQQVQPTLLSQFSQSDKASSKKEEHKG
FEDEVDDDESDEDEFDLKFPAEYHGKQQKPEQMIEEITSHDGKKQRFFDNGKKEVVFSNG
VRREVWPSGYSIVYFNNNDVKQTFPDQKVVYYFAEAKTTQTTFPNGLQVFKFSNNQIEKH
FQDGTKEISFPDGTIKCLFPDGEEESIFPDGTIQKIEKNGVRIIEFPSGQRDVLYPDGTK
VREFEDGSIKKIHADGRVEIIQAQKKKGSTTQPKNLNKYMNQPRKK