Identifiers and Description

Gene Model Identifier

Contig16008.0.g30

Standard Name

None

Aliases

Contig16008_0_g30

Description

Synaptobrevin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007278404.001416569413617e-37hypothetical protein
SGDYLR268W1.9998323414791308e-36SEC22 SGDID:S000004258, Chr XI
I from 680200-680844, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16008.0.g30(coding)
ATGTTAAAAAATACTTTTATATCTAGAGCTTCAGATGGCCTTATTTTGTGTGAAACCTAT
GACAGTGTGACAGATTCTCATGTTGAAAAGTTGAAATAAAAGGCAAAAGAGTTGTTAAAG
AAGATAGGAAATGCTAGTTAATACAGTACAGCAAATATTGAAGATCATTGCTTCCACTCT
ATGGTCCAAGATGGGATAGTGTATTTAGTAATAGCAGAGAAGAATTATCCTCAAAAATTG
GCATTTGTATATCTACAGGAAATTAACGAAGCATTTTAAGACGAATTAAGAAACACTTAT
GGCACAAGTGGGGTTGACTACTATTCTAAAATTGAAACTATAGAGAACTCTTATTCTTTC
TTGAAATTTGAGAAAGTTATAGCAAAAAAGAGAAAAGATTTTAGAGACACAAATGCCACT
GAAAATATCAATAAGCTAAACTAAGAATTAATGGATGTCAGTAAAATTATGAGTGAAAAT
TTTGAAATGATTCTCAATCGCGGAAACAATCTTGGGAAAATCTCGTAAATGTCATCTGAA
CTCAAAGACAGCTCTAGCAAGTTCAAGAAAGATGCAAAAAAGTTAAAGTTGAGGATGTGG
CTCAGGAAATATTCAACTTTCTTAATATTAGGTCTAGTACTATGTTTGTTTTTATTTTAC
TATTTTCTCTGA


>Contig16008.0.g30(protein)
MLKNTFISRASDGLILCETYDSVTDSHVEKLKQKAKELLKKIGNASQYSTANIEDHCFHS
MVQDGIVYLVIAEKNYPQKLAFVYLQEINEAFQDELRNTYGTSGVDYYSKIETIENSYSF
LKFEKVIAKKRKDFRDTNATENINKLNQELMDVSKIMSENFEMILNRGNNLGKISQMSSE
LKDSSSKFKKDAKKLKLRMWLRKYSTFLILGLVLCLFLFYYFL