Identifiers and Description

Gene Model Identifier

Contig15909.0.g95

Standard Name

None

Aliases

Contig15909_0_g95

Description

C2 domain of PTEN tumour-suppressor protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam10409 ) C2 domain of PTEN tumour-suppressor protein
  • ( pfam00782 ) Dual specificity phosphatase, catalytic domain
  • ( pfam00102 ) Protein-tyrosine phosphatase
  • ( pfam13350 ) Tyrosine phosphatase family
  • ( pfam05706 ) Cyclin-dependent kinase inhibitor 3 (CDKN3)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005389502.0008312485874125e-83hypothetical protein
SGDYNL128W5.0013199114200274e-20TEP1 SGDID:S000005072, Chr XIV
from 382359-383663, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15909.0.g95(coding)
ATGTTAGCTTAAGAGGGTTTTATTGGAGGTGCCTCCCCAGATCTTAGAGATTAATACTAA
ATGTTGACTACCGGGAATTTCTACAATTCTAACACAAATTAATATGGCTAGCCCATCGCT
AAAAATTCATAACAAAAACAATCATAGATTAACGAGGATATAGTCTTTAACAATCTGCAA
AGTATGAACAATTAGCACTTAGGAGGTTAAAACTAAAATCAAAATGAATATAGCGATTCA
GATGATAGTTCATATGCCTCTTCTACAGACGAGGAAGAGAGACTAGATCGGAAAGTAGAA
GAAGTTAATTAATTATTGGGGATATCTTATAAGAAAAAATCTCTCAATATTATAAAACGC
ATGGTTTCTAGAAAGAAGAGAAGATTTGTACAGGATGGATGCGATCTAGATTTAACATAT
GTAACTCCCAAAATAATTGCGATGGGATATCCAGGAGAACGACTAGAATAATTTTACAGA
AATTCTATGAAAGATGTATAAGATTTCTTTAAGAAAAAGCACTCAGGTTTCTATAAAATA
TACAACTTATGCAAAGAGAGAGCTTACAGTGATAAATGCTTTGAGAAAACTTGCTAGAGA
TTTATCTTTGAGGATCATAATCCGCCCCCTTTTGACATGATACTCCAGTTTTGTTAAGAT
ATGGAAGAATTTCTTAAAGAAGACGATAGAAATGTAGCTGCAATTCATTGTAAAGCAGGA
AAGGGTAGGACAGGAGTCATGATTTGCTGTTATCTTATATATGCTAGAGAGTTTAAAAGT
GCTCATGACGCTTTGGTATTCTATGGTAAAATTAGAACTTCAAATGGCAAGGGAGTAACA
ATTCCCTCACAGATTAGATATGTGTATTACTTTGAGAACTTTTTATAGCTAAAAAAATAA
ATGTACCCATAGAAAAACTTAACTCAAATGCCAAGGCAAGTGCTCAAAATCTACAAGATA
AGAATGATCACAATACCACAATTTTAGAATGGAGGAATTGAGCCTTCTTTCAAAGTGAAA
TTTAAAGATACAACTATTTATGATTATAAGTAGGAAGGAAAAACAAAGTTCCTTAGTTCC
TTGTCATACTATGATTTTAGAATAAAGAATCACAACTTATTAGTATATGATGATGTAAAG
ATTGAATTCTACAATAAAAACAAATTAACACAGAAGAAAATCTTTCACTTTTGGTTCAAT
ACCTCATTTATTGATAATTCTGGGGTCTTATCGATGGACAAGCCTATGATAGAAAAGGCT
TCTAAAGATAAAAAGTGCGCTGTTTTTGACAGAAATTTCAGAATTGAGGTTTATATGAGT
AGAATAAAGAACTATGAAATGGAAGAATGCTTCTTTGATAAAGATGTAGTGTTAGAACTT
CCAGTAGAAAATTTTACAGAAGAGCAATAATAACTATTAATGATGGCAGAAAATATGCCC
AGATTAGAAAGAAAATTGTCACTTTGA


>Contig15909.0.g95(protein)
MLAQEGFIGGASPDLRDQYQMLTTGNFYNSNTNQYGQPIAKNSQQKQSQINEDIVFNNLQ
SMNNQHLGGQNQNQNEYSDSDDSSYASSTDEEERLDRKVEEVNQLLGISYKKKSLNIIKR
MVSRKKRRFVQDGCDLDLTYVTPKIIAMGYPGERLEQFYRNSMKDVQDFFKKKHSGFYKI
YNLCKERAYSDKCFEKTCQRFIFEDHNPPPFDMILQFCQDMEEFLKEDDRNVAAIHCKAG
KGRTGVMICCYLIYAREFKSAHDALVFYGKIRTSNGKGVTIPSQIRYVYYFENFLQLKKQ
MYPQKNLTQMPRQVLKIYKIRMITIPQFQNGGIEPSFKVKFKDTTIYDYKQEGKTKFLSS
LSYYDFRIKNHNLLVYDDVKIEFYNKNKLTQKKIFHFWFNTSFIDNSGVLSMDKPMIEKA
SKDKKCAVFDRNFRIEVYMSRIKNYEMEECFFDKDVVLELPVENFTEEQQQLLMMAENMP
RLERKLSL