Identifiers and Description

Gene Model Identifier

Contig15891.0.g72

Standard Name

None

Aliases

Contig15891_0_g72

Description

Enolase, C-terminal TIM barrel domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00113 ) Enolase, C-terminal TIM barrel domain
  • ( pfam03952 ) Enolase, N-terminal domain
  • ( pfam01188 ) Mandelate racemase / muconate lactonizing enzyme, C-terminal domain
  • ( pfam07476 ) Methylaspartate ammonia-lyase C-terminus

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000464809.997093137033517e-262enolase family protein
SGDYGR254W5.002214508058008e-169ENO1 SGDID:S000003486, Chr VII
from 1000927-1002240, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15891.0.g72(coding)
ATGCTCTCAAAGATTACCAGAGGAATCACTCAATCTAACCGCAAGTTCTCCACTATTGCT
CAAATCAAGGCAAGAGAAATCCTTGATTCAAGAGGAAACCCAACCATCGAAGCTGATGTT
ATTACCTCAAATGGCCAAACATTCAGAGCTGCAGTTCCATCAGGAGCTTCAACTGGTATT
TATGAAGCTCTCGAACTTAGAGATAAGGACGAGAAAAGATATCTCGGCAAGGGAGTCCTT
CACGCTGTTGATAATGTACATAAAATCCTCAACCCTGCTCTCAAGGGTCTTAATGTCACT
GATCAAGTTAAGATTGATAAGTTGATGGTTGAGCAACTTGATGGTACTCAAAACGAATGG
GGATGGTGCAAACAAAAGGTTGGAGCTAATGCCATTCTTGCAGTCTCCTTGGCCCTCGCC
AGAGCTGGTGCTGCTGATAAGAGCGTTCCTCTTTATCACTACTTAGCTGAACTAGCTGGA
AAGAGAACTGACAAGTTTGTCACACCAGTACCATCACTCAATATCATCAATGGAGGAGCT
CATGCTGGTAACAGTCTTGAAATCTAAGAATTCATGATTATGCCAACTGGAGCATCATCT
TTCAGAGAGGCAATGAGAATTGGAGCTGAGACCTATTAACATCTCGCAAAGCTTCTTAAG
AAGAAGTACGGAAAGTCAGCTGCTAATGTTGGAGATGAGGGTGGATTCGGAGCACCATAA
ATTAAGGATGAGATTGAGACTCTCGATTTAATCTTAGAGGCAATCCAAAGTGCTGGACAC
ACTGGTAAAATAGATATTGCTCTTGACGCAGCTGCTTCAGAATTCTTTGATAGCAAAACT
GGAAACTATAACCTTTCATAAAAGCAAGGAAAGACCGACAGAGTCCTTACTCCAGCACAA
TTGATCGATCTCTACGAGAGCTTGACCAAGAAATACCCAATTAAGTCAATCGAAGACCCA
TTCGATCAAGATGATTTCGATGCTTATATCAAGCTTACTCAAAGAATCGGTAAAGATATC
CAAATCGTTGGTGATGACTTGTTGGTTACCAACCCAAAGAGAGTGCAAAGAGGTATTGAT
GGCAAGTGGGTTAATTCTCTTCTCTTGAAGGTCAACCAAATCGGTAGTGTTACTGAATCA
ATTGAAGCTAGCAACATGTCATAAAAGGCTGGCTGGGGAGTTATGGTGTCTCACAGAAGT
GGAGAGACTGAAGATAACTTTATTGGTGACCTTGTAGTTGGTCTTGGCACTGGTGAGATC
AAGAGTGGTGCTCCATGCAGAAGTGATAGACTCGCTAAGTACAATCAAATCATGAGAATT
GAGGAAGAACTTGGAAGCAGAGCTGTCTTTGCTGGCAAACATTTCAGAGATACCTCAAAG
CTTTTATGA


>Contig15891.0.g72(protein)
MLSKITRGITQSNRKFSTIAQIKAREILDSRGNPTIEADVITSNGQTFRAAVPSGASTGI
YEALELRDKDEKRYLGKGVLHAVDNVHKILNPALKGLNVTDQVKIDKLMVEQLDGTQNEW
GWCKQKVGANAILAVSLALARAGAADKSVPLYHYLAELAGKRTDKFVTPVPSLNIINGGA
HAGNSLEIQEFMIMPTGASSFREAMRIGAETYQHLAKLLKKKYGKSAANVGDEGGFGAPQ
IKDEIETLDLILEAIQSAGHTGKIDIALDAAASEFFDSKTGNYNLSQKQGKTDRVLTPAQ
LIDLYESLTKKYPIKSIEDPFDQDDFDAYIKLTQRIGKDIQIVGDDLLVTNPKRVQRGID
GKWVNSLLLKVNQIGSVTESIEASNMSQKAGWGVMVSHRSGETEDNFIGDLVVGLGTGEI
KSGAPCRSDRLAKYNQIMRIEEELGSRAVFAGKHFRDTSKLL