Identifiers and Description

Gene Model Identifier

Contig15886.0.g14

Standard Name

None

Aliases

Contig15886_0_g14

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001449409.000740126599256e-127Protein kinase domain containi
ng protein
SGDYBR160W7.997908857293895e-55CDC28 SGDID:S000000364, Chr II
from 560078-560974, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15886.0.g14(coding)
ATGGATAAGTATAAAATTATTAAGACATTAGGAGACGGTACATATGGATCCGTCGTTTAA
GCTTAAAATAAGACATCTTAAGAAATCGTGGCCATTAAGAAAATGAAAAAAAAGTTCTAT
TCATGGGAAGAGTGTATGGCTCTAAGAGAAATCAAGTCACTGAGAAAGCTTAATCAAATC
AATATTGTGAAACTGAAAGAAGTTATCAGAGTTAATGATGATTTGTACTTTGTCTTCGAG
TACATGGAGTAAAATGTTTATCAGCTTATGAAAGACAGAACATCAAACTTTCCAGAAAAT
TAAGTAAAAACAGTAATGTATCAGACTATACTGGGTCTCGCTTACATGCATAAGCACGGA
TTTTTCCATAGAGACTTGAAACCTGAAAATTTACTTGTAAAAGGAGAAGCTGTTAAAATT
GCAGATTTTGGTCTTGCAAGAGAAATCAGATCTCGTCCACCATTTACTGATTACGTGAGT
ACTCGCTGGTATAGAGCTCCTGAAATTCTATTGAGATCTACTAATTACAATTCTCCTGTA
GATATTTTTGCATGTGGAGCTATCATGGCTGAACTTTACATGCTTCGTCCGTTGTTCCCC
GGAAATAATGAAACTGATTAAATTTACAAAACTTGTGCTGTATTGGGAAGTCCTACTCAA
GCATAGTGGCCAGAAGGTTACAAACTAGCTTCAAGAATCGGCTTTACTTTTCCAAAATTT
GTACCAACTTCATTAAGTTAGCTGATACCAAACGCTTCAGAATAAGCCATAGATATAATG
CTAAAAATGATGATTTTTGATCCACAAAAGAGACCCACTGCACAATAATGTTTGTAACAT
CCCTATTTCGAAGGATTCACCTATAATCCAGCTGCTAATCCAGTACTATAGGGAGCAAAC
AGTTCAAATAAAAATTTCTTCAATCCTAATAATGATATTAACAAACCAACTTCAAATTCT
AAACGCATTGAATCAAGAAAAGGAATATTGTCGCGTAAGGATGATGTCAACAAAAACAAC
TTCTATATGCAAAAGGGTTAACCTTACGCTCTACCTAATAAGCCAACTGTGGTAGGAAGT
GGTCACGGAAGTAGTGAGAGCGTTCCTCAAGGCTACTTCAACAAAGGACCTATAGGTAGT
GGAATAAGCAACAGTGGGAGTGGAGTCAACTTGCCTCAGCTGAACAATCCTTATGTCAGC
TCAGCGCTGAAAAACTCAGCTATTGGATAAAACAGAAATAAAAGTTTGCCTCAGTATTAA
GGATACAAGTATGGAGGAATAGGGGGCTCTGGTATAGGTGGAGGAGGAGGCATAGGAGGC
TCCAATTTTGACAGTAATACAAATGCATATGGTCATAATGAACAAAGCATTTAAGGAGCT
CAGGGTAGTATAGGATCCTCTGGAGGTCTTCCTAGAATACAGAGTAGAGGTGGTGCTGCT
CTTCCAGGAAATAATGTGCCAAATTCAAGAGGCAGTGGATTAGCCGGTTACGGAGGTCAA
GCAATGGGAAGCATACCGAAATACGGAGCAGGGTCAGGATTAAACTATTCAGGTGCGCAA
GGAGCTGCATAGAATGTTCCAACAATAGGCTCTTATAAATATGGAAGTGGCTCTGGCATA
GGAGGCCCAGTCGGATCTCTAAATAGTGGAGGAGCTGGTGGTTTCAGTATACCTAAATAT
TCTTCTTCGGGTATTGCAGGAGGTATAGGTCAGCTAAATCCTATTGGAAGTGCTTCTAAT
AATAACGATAAAATATGA


>Contig15886.0.g14(protein)
MDKYKIIKTLGDGTYGSVVQAQNKTSQEIVAIKKMKKKFYSWEECMALREIKSLRKLNQI
NIVKLKEVIRVNDDLYFVFEYMEQNVYQLMKDRTSNFPENQVKTVMYQTILGLAYMHKHG
FFHRDLKPENLLVKGEAVKIADFGLAREIRSRPPFTDYVSTRWYRAPEILLRSTNYNSPV
DIFACGAIMAELYMLRPLFPGNNETDQIYKTCAVLGSPTQAQWPEGYKLASRIGFTFPKF
VPTSLSQLIPNASEQAIDIMLKMMIFDPQKRPTAQQCLQHPYFEGFTYNPAANPVLQGAN
SSNKNFFNPNNDINKPTSNSKRIESRKGILSRKDDVNKNNFYMQKGQPYALPNKPTVVGS
GHGSSESVPQGYFNKGPIGSGISNSGSGVNLPQLNNPYVSSALKNSAIGQNRNKSLPQYQ
GYKYGGIGGSGIGGGGGIGGSNFDSNTNAYGHNEQSIQGAQGSIGSSGGLPRIQSRGGAA
LPGNNVPNSRGSGLAGYGGQAMGSIPKYGAGSGLNYSGAQGAAQNVPTIGSYKYGSGSGI
GGPVGSLNSGGAGGFSIPKYSSSGIAGGIGQLNPIGSASNNNDKI