Identifiers and Description

Gene Model Identifier

Contig15751.0.0.g87

Standard Name

None

Aliases

Contig15751_0_0_g87

Description

Ras family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00071 ) Ras family
  • ( pfam08477 ) Miro-like protein
  • ( pfam00025 ) ADP-ribosylation factor family
  • ( pfam04670 ) Gtr1/RagA G protein conserved region
  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam02421 ) Ferrous iron transport protein B
  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam13191 ) AAA ATPase domain
  • ( pfam09439 ) Signal recognition particle receptor beta subunit
  • ( pfam03193 ) Protein of unknown function, DUF258
  • ( pfam00004 ) ATPase family associated with various cellular activities (AAA)
  • ( pfam13401 ) AAA domain
  • ( pfam13555 ) P-loop containing region of AAA domain
  • ( pfam07728 ) AAA domain (dynein-related subfamily)
  • ( pfam13207 ) AAA domain
  • ( pfam13479 ) AAA domain
  • ( pfam13175 ) AAA ATPase domain
  • ( pfam03205 ) Molybdopterin guanine dinucleotide synthesis protein B
  • ( pfam14022 ) Protein of unknown function (DUF4238)
  • ( pfam01637 ) Archaeal ATPase
  • ( pfam10662 ) Ethanolamine utilisation - propanediol utilisation

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003162804.0007753645635287e-88Ras family protein
SGDYFL038C9.003043785111664e-83YPT1 SGDID:S000001856, Chr VI
from 55986-55366, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15751.0.0.g87(coding)
ATGAACCCAGAATACGACTATCTCTTCAAGGTATTGCTCATTGGTAACTCAGGAGTCGGT
AAATCCTCTCTCTTGCTCAGATTCGCTGACGATGTGTTCACAGACAACTTTATGCCAACA
ATCGGAGTCGACTTCAAAATCAGAACTATTGAAGTAGACGGCAAGACAATCAAGCTCCAA
ATCTGGGACACTGCAGGCCAAGAGAGATTCAAGACCATCACCAGCAGCTATTACAAAGGT
GCTCACGGTATCATTGTTACCTATGATATTACTGATCGCGAGAGTTTCAGCGCTATTGAG
AACTGGATGAACGAAGTCGAGAAGCACGCTTCAGACAACATCTCCCGTATCCTTGTCGGT
AACAAGAGCGATATGGAAGACGCTAGACAAGTCTCAACAGACGAGGGTAAAGAGCTCGCT
GAACATTACAACGTCAGATTCCTAGAGACATCTGCTAAGGACTGCAAGAACGTCGAGGAA
GCTTTCACTATGATGACCAGAGAAATCAAATCAAGAGTCGCAATTACTCAACCAAAGAAA
GCCACCGAATAAACTTAAGCTCAAAGAATCAACAAAAATCAACATCAAACCAAAAAGATT
CAAGAGAAGAAGGGCGGCTGCTGCTGA


>Contig15751.0.0.g87(protein)
MNPEYDYLFKVLLIGNSGVGKSSLLLRFADDVFTDNFMPTIGVDFKIRTIEVDGKTIKLQ
IWDTAGQERFKTITSSYYKGAHGIIVTYDITDRESFSAIENWMNEVEKHASDNISRILVG
NKSDMEDARQVSTDEGKELAEHYNVRFLETSAKDCKNVEEAFTMMTREIKSRVAITQPKK
ATEQTQAQRINKNQHQTKKIQEKKGGCC