Identifiers and Description

Gene Model Identifier

Contig15751.0.0.g86

Standard Name

None

Aliases

Contig15751_0_0_g86

Description

Urm1 (Ubiquitin related modifier)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006494001.9999391735788327e-19hypothetical protein
SGDYIL008W0.000000000000001999258566166494URM1 SGDID:S000001270, Chr IX
from 342536-342835, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15751.0.0.g86(coding)
ATGAAAGTACTCGTAGAATTCAGCGGTGGTCTTGAGTTAATGTTTGAAGGCAAAAAGCAT
ATAGACGTAGATCTCCCAGAAACACATACCACATTGGAGAATCTTGTAGATTTCTTGAAA
AAGCATAACTTGAAGGACAAGGAAGAGATGTTTGTGCAGGGAAGTTCAGTAAGACCAGGA
ATCATCGTATTGGTTAATGATACAGATTGGGAACTTCTTGACACACTTCACTATAAGATA
CAGGAGAGAGATTAAATCGCATTCATCTCTACTTTACATGGGGGTTGA


>Contig15751.0.0.g86(protein)
MKVLVEFSGGLELMFEGKKHIDVDLPETHTTLENLVDFLKKHNLKDKEEMFVQGSSVRPG
IIVLVNDTDWELLDTLHYKIQERDQIAFISTLHGG