Identifiers and Description

Gene Model Identifier

Contig15747.0.g74

Standard Name

None

Aliases

Contig15747_0_g74

Description

ERCC4 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006248701.9991095569230066e-20ERCC4 domain containing protei
n
SGDYDR386W0.0000020007268868677913MUS81 SGDID:S000002794, Chr IV
from 1246084-1247982, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15747.0.g74(coding)
ATGTCAAACTTTTTTCGCGGTCGAGGCCGTGGTCATTATGCATTGGCAAATAGAAACAAC
GCAGCTTCAGCGACTCAATCACAATAAAAACGGGTGGTATACAAAACCCCAAAAACAGCA
GCTAACCAACTAAATTAATACTACCTTGATGCTTTTATAAAATTGAAGAAGGATTGCGAT
ATGAGGGGAAACAGTAATTTCTCATTGACCTACAAAAGAATCATTGGGGCTCTGAGCAAA
TATCCCATGCCTATTTTATGTGCTCAGTAAACTCTACTTCTTGAAGGAGTTGGAGATATA
CTGGGGAAGAGATTTTCGGAGTTGATAGATGCCAGACACAAAGAATTTGAGGATTCAGCA
TTTGAGATTGAATTACTTAAACAGCAAGGGAAAAATATTCCGAGAGAACGACGAACATTT
GCTGGGTTGCTCATTCCTGAATGTGATATCGATACAATAAGTACTTACAGCCTTAAACAG
TACTTAGTTAGGAGAGACATGCAAGTTTATAGAATTAATAATGGAATGGACGATTTATCC
TCTGAGAATAGCAAGAAAAGAAAGTTCAATCAGATCAGCAATTCCGAGCAAGAAGAGGAG
ATTCTGGCAAATGGAGCAAAAAAGAAGAAACCTAATCACAATGACTCATCTGCTTTTCTT
GACACTGGATCAGTCTCGTGGTCGATGATTATTGCCATTTATTTCCTATCCTTGCATGAT
GATCGAAAGAGCTTCTATATTACTATGTCAAGTATTGTCGAAATGCTTGAAGTCCTCAAA
AATGAGTTTAGTGATTATATGCCTTTTGAAAATGACCCAAAAATGCTTGAGCAATTTTCA
TCAGGAGACCTCATAAAATTCAAAGAAAACAGCTTTATTGAAATAGTGGAAAGCACTGTA
GCAAAAGATCCTTAAGAATGGAAATTTAGTATGACTGATAAAGGTAAAAATCGTGCAAAG
AATCTTTGTAAAGGTGTTGGACTGCAAATTTAACTTGAAACAGATTTAGAGAATCCAACT
AAAAACAAAATTACCATAAACATGTATGATAAAGACTTAATGCCGGTGGTCGACTAGCTC
TACATGTTAGATGGTACTTAAGTATAGCAATTAAAATAGGAGAATAGTTTGATAAATAGA
AACTAAATCTTTGATCCTTTTGTCTATTCAAATGAAATAAAGGGAAACCTAGGAAGTAAA
CAAATTAATCAATTCTCGCACTGCAAGAAAGAAGAAACCTCAAACATGTTGAACTAGAGT
ATATTTGGGAATTTAATTGATCTTGCAAATAAAGACTTAGAAGAAGACGAGGATGAAAAG
GACCAAGATGACGACGATTTAATGATGATGGATGATGGCCCGTATGATAGTTAGATTGAT
AGCCTTCTATCGAAAGATTTCATGAATTTGATGAGCGATAGAGAAAATTCTAATTAACCA
GCACCTTTGCAATCTTTAGCATCATTGCAAGCTGTTAGTAATTAGCTCACATTCCCTTGT
TAAACATCCAAGTAACATATAAAAACTGATTCAAAGCAGTAAATAATCAAACAAGAAAAG
AAGTTACTCAAGCAGCTTAACTCAGATTTCCAATAGGCAACTAGTGAAGTAATTTTGTAT
GTTGATAACCGTGAGAAGAAAAATTAGCGAGATGTAAGAAATCCTAGTTCTTTCGATATT
GAGGATGAAGAATGTATAGAAGACGAAGAGTAAAACAATACCAAAAAGAAAAGCAAAAAG
AATCCTAATGGGACTAAAAAAGCGAAGAAGAAGCAAGCAGCTCAAAAAGAATATATAGAT
TATGTTTTAGACTTTATTTGTGAAAGAAAAACTGCTGATGATTTGGCGGCTTCAATTCTT
GATGGTAGATATGATGAGCAAAAGTTTAGATTGAAAAATAGTGAAATTAACAATGTAATC
TATTTGGTAGAGGGTAAACCATCTCAATATTGTAAGATTCCCCTGTAAGTACTGAATAAA
GCCCAAATTCACACATAAATTTTTCACGGATTCAATGTCTTGAGAAGTGATACTATTGCT
CAGACATTAAAGTGGTTGACTGATATGACTCGTGAAATCAAGATTAGAATTGGTTAGATG
AAGTAGACTCAGAAGAATTTCGAGAATAATGTTAAGGATACTCTTATAGATTTCAAACAC
TTCTCAAATGAGAGTGGTAAGAACTCGAACTTAGATGTTCAGCACATCTTTTCAAGATAA
CTGAGAACAATAAAAGGCCTAGGCACAGATCATGTTTCCACTATCTCTCGTGTTTTCAAG
ACTCCCTATTTAATGTATGCTACTTTCAAAAAATGTGGAAGCGATGAGAAGAAATGCCTA
AATTTACTAAATGCAGGTAAAATGGAGCTCATGCGCTCAGAGTAAATGTATAGATAAGGC
CTTAATATCTCTGATTAAGTCATTATTACCGATGAAGGAAACCCTTCAATCCCTAAGAAA
ATTGACGACACAGATAAAATTGATTTATAAAATGTAATTATAGCTGCTGACCCCAAATTC
TTTAACAAGGTCCTGAAATAATTTGAATAAAACGCTGGAATAAAAATGCGCAAAATTAAT
AAAAATTAGAGCGAAAGTATATATTCACTCTTCTGCCAGGCTAGCTACAAATATAGAAGT
AAAAGTAACAATGGAAGAAACAATAAAAACTTGGATGAAGAAAACGACTATGAAGATATG
GAATGA


>Contig15747.0.g74(protein)
MSNFFRGRGRGHYALANRNNAASATQSQQKRVVYKTPKTAANQLNQYYLDAFIKLKKDCD
MRGNSNFSLTYKRIIGALSKYPMPILCAQQTLLLEGVGDILGKRFSELIDARHKEFEDSA
FEIELLKQQGKNIPRERRTFAGLLIPECDIDTISTYSLKQYLVRRDMQVYRINNGMDDLS
SENSKKRKFNQISNSEQEEEILANGAKKKKPNHNDSSAFLDTGSVSWSMIIAIYFLSLHD
DRKSFYITMSSIVEMLEVLKNEFSDYMPFENDPKMLEQFSSGDLIKFKENSFIEIVESTV
AKDPQEWKFSMTDKGKNRAKNLCKGVGLQIQLETDLENPTKNKITINMYDKDLMPVVDQL
YMLDGTQVQQLKQENSLINRNQIFDPFVYSNEIKGNLGSKQINQFSHCKKEETSNMLNQS
IFGNLIDLANKDLEEDEDEKDQDDDDLMMMDDGPYDSQIDSLLSKDFMNLMSDRENSNQP
APLQSLASLQAVSNQLTFPCQTSKQHIKTDSKQQIIKQEKKLLKQLNSDFQQATSEVILY
VDNREKKNQRDVRNPSSFDIEDEECIEDEEQNNTKKKSKKNPNGTKKAKKKQAAQKEYID
YVLDFICERKTADDLAASILDGRYDEQKFRLKNSEINNVIYLVEGKPSQYCKIPLQVLNK
AQIHTQIFHGFNVLRSDTIAQTLKWLTDMTREIKIRIGQMKQTQKNFENNVKDTLIDFKH
FSNESGKNSNLDVQHIFSRQLRTIKGLGTDHVSTISRVFKTPYLMYATFKKCGSDEKKCL
NLLNAGKMELMRSEQMYRQGLNISDQVIITDEGNPSIPKKIDDTDKIDLQNVIIAADPKF
FNKVLKQFEQNAGIKMRKINKNQSESIYSLFCQASYKYRSKSNNGRNNKNLDEENDYEDM
E