Identifiers and Description

Gene Model Identifier

Contig15709.0.g85

Standard Name

None

Aliases

Contig15709_0_g85

Description

Dynein heavy chain and region D6 of dynein motor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03028 ) Dynein heavy chain and region D6 of dynein motor
  • ( pfam08393 ) Dynein heavy chain, N-terminal region 2
  • ( pfam12774 ) Hydrolytic ATP binding site of dynein motor region D1
  • ( pfam12780 ) P-loop containing dynein motor region D4
  • ( pfam12775 ) P-loop containing dynein motor region D3
  • ( pfam12781 ) ATP-binding dynein motor region D5
  • ( pfam12777 ) Microtubule-binding stalk of dynein motor
  • ( pfam07728 ) AAA domain (dynein-related subfamily)
  • ( pfam00004 ) ATPase family associated with various cellular activities (AAA)
  • ( pfam13207 ) AAA domain
  • ( pfam13401 ) AAA domain
  • ( pfam00910 ) RNA helicase
  • ( pfam01078 ) Magnesium chelatase, subunit ChlI
  • ( pfam13191 ) AAA ATPase domain
  • ( pfam13245 ) Part of AAA domain
  • ( pfam13604 ) AAA domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009474309.997093137033517e-262Dynein heavy chain family prot
ein
SGDYKR054C9.997093137033517e-262DYN1 SGDID:S000001762, Chr XI
from 547925-535647, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15709.0.g85(coding)
ATGTAAGGAGCAGCGGGTGATATACCCAAGTAGCGTGGTATCTACTCTGAGATACTAACT
ACTGAGGACACTGAAAATCTAAAATTAGTTTCAACTATTGGTCCTTCAGCCAACAATGTT
ATTCATTCAAACGTTAAATAAAAGATGCCAAGAGCTCTAGGAATAAAGCGTAAGCCACAG
CCAATCGTTGAAGTGGTCGCTAACAAAGAATAAAAAGTGGCAAATGCGTTTTTGGAAAAG
AGTGGAATAATACTCGGTAAAAACTACTTCAGAGATGCGAATGTCAACTTGGGCTTCTAT
TCTAAAAAGAGAGAAGGAGTTGCAGATGTTGACCCAAAGGTCATGGAGCCGTTCATTCCT
ATCCCAGGAAAGCCACCCAGATAAGTCGTTATTGATAGACAAAGAAAGTTGTTTGCATCT
TTAAGTATAGAAGAACTGTTATTAGAACTTGGCATCGACTATTCAAACCCTTAGAAAAAT
CAAGCTGACTGGCTACCCCTTGAACCCTTTGATGACACAGAATATGACTGCAGACTACCA
GAGGAATGGCTAGAATACGGCAAGGACGTGGTCACTGGAAAATTTGCACCCATTCCAGGC
AAAGGTCTATGGTATGACGATGAAGGAAGAGGCCATTGGAGATCAGTTCTCATTCATTCC
TACGATTAAGATCGTAACAATTATACAGGAACATGGGATGATGATCAAAATGGTTACTGC
GAACTCACTCGTATCAACTTGCTCTTCAACGCCGAGGATCCAAGAATCTTTGCTTAAAGA
GTTGCTTAAGCTCATTAAGAGAGAATTTACGCTGACTCTCAAATAAGATACAACTTTTTC
ATTGATAACATGCCCACTAGCTCGGAGTTACCTGAACTAGACTCTGAACAACAACACAGA
ATCCTTTAAATGGCAACTGCCTCAAGATACCTCAAATAAAGAGGCAGCGTTGAGACAAGC
AGCATCTTACAAGAAGTCAACTTAGACTTTGGAAGAACTATGAACTGGATTATCATGGAT
AAGACCATGGAAAAGCCTATTGAATAACTGAAAGAGATGATCCCTGCTAATTTAACTTTA
CCACCAAAGGCGCCATTAAGGGATACTCCATATTTTGGAATGACTCCTATCCCCTAACAT
GACTTCCCAGAACAATTCTCAAACTTCTGCTTTAACTCACTCTACATCAAAGAGGAAGTT
ATCAAGGCTATGGTTGAGATTAGAGCTGAATGCAACTAGCTACTCTAAGATAATAAAATC
TTCGATGTTTCCATAAATAAAACATTAAGAGTGGAAGAATTTAAATAAATTCAATCTTCA
AGTGTTGCTTAAATAAGATTCAACACTAGAGAGACTGGCTGGGTTGGCAGACTAGAGAAG
ATCATTAAGGCCTCGTTCACAGAGGTAGGCAAGGGGTGGTTCAACATCCATGAGACTTCT
AAAGAGACCTATGAGTTTGGAAAACTTAAGAAGTTCTTAACTTTGATAAACTTTATGATG
CAAGATACCATTCTTACGATGTGTAAAGACTCCGTAAAATAGTTTGTTCTATTCATGGTA
TAGTTCATACCAAGAGAGACATTAATTCTTTCCACCTCGGAGGTGAAAAACACATTTGAG
AAGATTCAAATAGAGGCAGAAGAAGAGGAATAAATAGAAGAGGAAGATATTCCTGAGAGC
GAAATGACCACAATTTAACTAGTTAAAAAAGAGATCAACAAAATGTTCGACAAGAACAAG
GACCCTGAGCCACTCTTTGTTTTGGACTTGATTCTCAAGCCTAATTAGCTAATACCTCAA
TATTCCACTGATCCAAAGGAAATCGTAGCTAAGATCATGGAAGTCTTTGATGAAGGTATT
GAATGCCTTCAGCAAATTCCATAGTTAGAACCTATCTTGCTCAGACATCTTTTCAAAACA
CATGGCAAGAAAATGCTCAAAGCTCCTTTGAGACCGAGAGAGGAGCCAAAGAGAAAGCCA
GACGACACTAACAATAAAAAGTTCTTACCGGATGAGAACATTTGGTTATGGGATTCCTAC
TTTGCAATTAGAAAAGGACTTGAAAAATCTATCGAGCCACTCTACGAATACGTCAAGACT
TTCACAAAGTTTGAGGGAGAAAACAAGCTAAACCCTGATAGATATGTCAGAAGTTTAGAT
GAAGGAGAAACTCCAATCACTGCTGAAGGTCTTAAGCACAACATAGAAGAGCATAGAAAA
GAAGAATAAAGACTCAAGGACGATATCCCAGAGAGTATAGTAGTCTCTATCTTCCAAGTA
AACTGTAAAGATATTCGCAACATGTACGTGGGCAAGCACTCAAGTATCATAGATAAGGAA
ATCAAACTTATCGCTTAAAAAGCAAAGGACACTAACTACACCCTATCTACTAAGTTTGAT
GAGATCAACGAAAGAATCAGAAGACCTCCCAAGAACATTGAAGATTTAACTGAGACTAGA
AAATACATTTCTGAAATTCCAGTTGAGATTGAGAAGCTCAAGAAATCAATTAACGAGTGC
ATGGGCATCTACAATATCCTTGACGAGTTTAACTATGAGTTTTCAAACACAGAGAATGAC
TAAAAATGGTGGCTCTTTGGATCACCTTAAAAGGTTGTATCTGTTATTGATTCTCAAAGT
CAAATCCTTGAAAAGCAAAAAGAAAACTTTGTAAAAGCAATGGAAGCTGAGTAAGAAGAG
TTCGAGGAAACTCTAAACAATCTCGAAATCACAGTTGGTGGGTTCCACGCCTTCGATGAT
CTGAATAGATATGAAGAAATCGCTGTTGATGTTGAGTCTGTAAATTCAAGACTTTAAGAT
TGCATTGAGCAGTCTCGTCTCTATAATCAAAGAGAATTCCTTGTTGGAAAAGATCAGAAA
GACTACACTAGACTCTAACAAATGGCAAAAGAATTTTAACCATACTCCAACCTTTGGCTT
ACTACTAGAAACTGGTTCAAGTCTCACCACAGCTGGCTAAATGATTCTTGGGAAGACCTT
AATGCTGTTGAACTTGATAATACTTTCGATCAATCAAACAAAACTCTTTCAGCTGTATTG
AGATACTTCAGAGATAAAGATTTCCCCAAGATTACTAAAATCGCTGAAACCATGAAAAAG
AACATAGATGATTTTAAACCTTACGTACCTTTGGCTGTAGCTTTAAGAAAAGATGGAATG
AAGGAAAGACATTGGGACTAAATCTCTGATAAAGTTAAGTTTGATATAAGACCAGTTGAA
GGCTTCACTCTCACCTCAGTAATTGAAGCTGGTATGCTCAAGCATATCGATGTTTGCGAG
GAAGTAGGAGAGAAAGCTTACAAAGAGTACCATATCGAGAGATCTTTGAACAAGATGGTT
GGTGACTGGAAAGAGTGTAACTTCCTTCTGCCACAATTCAAACAAACAACAACAAACTAT
ATTGCTGGATTTGATGATGCTATTACCATGCTTGACGAGCATATAGTCACAACACAAGCC
ATGACTTTCAGTCCTTTTAAAAAGCCATTCGAGAAAGAAATTGAAGAATGGAATACTAAG
ATGATATTAGTATCAGACACTCTTGAAGAATGGGTTAAGTGCTAGAGCTAATGGATGTAT
TTACAACCAATCTTTGACAGTCCTGACATCATGAAGCAACTTCCACAAGAAACTAAGAGG
TTTAAGTCAGTTGATTCAACATGGAGACATATCATCACTTAAACTAAACAAGCGCCTAAC
ATTCTAATGACTTGTTCAAAAGAGGGTCTTAAAGAAAAGTTCCAAGAGGCCAACAAAAAC
TTGGAAATTGTCCAAAAAGGTCTTGCCGATTACTTAGAAAAGAAGAGATCAGTATTTGCA
AGATTCTATTTCTTATCAAATGACGAACTCCTTGAAATTCTTTCACAAACAAAGGAGGTC
AGAAACGTGAGACCACATTTGAGAAAGGTTTTCGAAGCTATGGCTGATTTGGAATTCAAG
GATGACGACACTATTTGGGCAATGTTCTCAGGAGAAGGAGAAAAAGTCAATTTTGTTAAG
AAAATCGATCCAAAGGATAGAAATGTAGAGTACTGGATGGGAGACGTTGAAAAAATGATG
CAGCTTTCAGTCAGAAACGTACTTCTCAAGTCTATTGAAGACTATGTTGTAAGACCAAGA
AATGATTGGGTACAACAACATCCTGGTCAATGTGTTCTTAATGGTTCTTAAGTTCACTGG
ACTACTGAAGTTGAAGAAGCAATAAGAACTAAAGGTGTTCAAGGTATATAGGAATATCTC
GATAATTTAAACAAGCAACTTATTGACACTGTCGTGCTTGTTAGACAAAAACTAACTAAA
AATGCTACTATCACTATCAATGCATTGATCGTTATTGATGTACATGCTAAAGACGTTGTA
GCAAAGCTTGTAGAGGAAAAGGTCGAAGATGTCAATGCTTTTGAATGGATCTCACAATTA
AGATATTACTGGGAGAATGATGATTGTTATGTTAAGTGTGTACAAACAAACTTCCCTTAT
GGTTATGAGTATCTTGGAAACTCTTTAAGACTGGTTATTACCCCATTGACTGACAAGTGT
TATATGACTTTAATGGGAGCTCTAAATCTTAACTTAGGAGGTGCTCCAGCAGGCCCTGCA
GGAACAGGAAAGACTGAATCAACAAAGGATCTTGCTAAGGCTCTTGCAAAACAGTGTGTC
GTGTTCAATTGCTCAGATGGAATGGATCATATTATGGTAGCTAAGTTCTTCAAAGGTCTT
GCAAGTGCTGGAGCTTGGGCTTGTTTCGATGAGTTTAACAGAATAAATATTGAAGTGTTG
TCAGTTATAGCCTAACAACTTTTGGTTTTATTCAGAGCAAAGGCTAACAATGATCCTGAA
ATTATCTTTGAAGAGTCACTGATTAAGATGAAACCAACCTTCTGTGTTTTCATCACAATG
AATCCTGGTTATGCCGGTCGTACTGAACTTCCAGATAACTTAAAGGCTCTTTTCAGACCA
GTGGCTATGATGGTGCCAGATTATGCTTTGATTGGAGAAATTATGCTTTATTCCTTTGGA
TTTTTGACTGGTCGTGATCTTGCTAGAAAGATGGTCACTACTTTTAAACTTAGTTCAGAA
CAACTATCATCATAAGATCATTATGATTATGGAATGAGAGCTGTAAGATCAGTTATCAAT
GCTGCAGGTTTACTTAAGAGAGCTAACCCAGATATGAATGAAGATCAGCTTTTACTGAGA
GCCTTGAGAGATGTTAATGTACCTAAATTCTTGAAAGATGATCTTCCACTTTTCGAAAAC
ATTATTCTCGATCTTTTCCCTGGAGTTGATAAGCCATAAGTAAACTACGGAGGCCTTTTC
GGCTCTCTAAATAACTCCTGTGCTCATTTTAATCTATAACCTGTAGATCAGTTCATTATG
AAAATTATACAGCTTTATGATACCATTTAAGTTAGACATGGTCTCATGTTAGTTGGTCCA
ACTGGAGGTGGTAAAACTGCTAACTATAAGATTCTTCAACACGCTATGTCTGCACTATCT
GGCTAAGATTCATTTGTAAAGGTGCACGTTGATATCTTAAATCCAAAGTCAATCACTATG
GGACAACTCTATGGTTATGTCGATGCTCAAACTTCTGAATGGCAAGATGGTGTCTTAGCT
AAATTGGTACTTGAATGCACAAAGGACGAATCACCAGATCTTCATTGGGTTATGTTCGAT
GGTCCAGTCGATGCTATTTGGATTGAAAACATGAATACTGTGCTAGATGATAATAAGAAA
CTTTGCTTAAATTCTGGTCAAATTATTACTCTTACAAGCAGAATGACCATGATGTTTGAG
GTTGAAGATCTTGCAGTGGCATCTCCAGCTACTGTCTCAAGATGCGGTATGGTTTATATG
GAACCTGCAAGTTTGACTCTAGAACCACTTGTCATCTCATGGTTGAATTCACTACCAGTA
AAGATAAAGGAAAATAAGAATATTGTCAACAGACTTTAATTCCTCTATGACAACTTCTTA
AATGATACATGCTACTACATGAGAAAGAATTTGACTGAGCCTGTAAAAACTGTAGATAAC
AACATTACATAAAGTTCTATGAGAATATTAGAATGTTTCTTCGCTAACTATGTTGAGTCT
GAAATTAAGAAAGTTCCTAAAGAAGAAATTGCAAATCTAGAATCTATGATTACTCAACTA
TTCATCTTTGCTATCATTTGGTCAATTGGTTGCACCTCTACATTAGATGGTAGAATGAAG
TTTAACAGTTGGTTTAGAGAAAGAATGCAAACCCTTCAAATAGATTTCCCAGAGGAGAAA
CTAGTTTTCGACTATAAATTCAATCTTGAAACAAAAGAGTGGTAGTACTGGAAAGATACC
ATTTCTGAGTACAACGTAGATATCAAGGTGAGCTATAATGAAATCTTAGTGCCCACAGTT
GACTCAATCAGAATGAAATTTTTGACAAAGTTCTTGGTTATGAATGGAAAGCATGTTTTA
ACTCCAGGACCAACTGGTACCGGTAAGAGTGTGAACATCTAAGAACTGATGACCTATGAA
TTGCCTGAAGAGTTCCAAACTTTGGCAATGACTTTCTCTGCTTAAACCTCAGCAAATTAA
ACTCAAGATTATCTAGATGATAAGTTTGAGAAGAGAAGAAAAGGAGTTTATGGACCACCA
GTAGGAAAGAAGTTCGTCATCTTCATTGATGATATGAACATGCCAAAGAAAGAAGAATAT
GGAGCTCAGCCACCACTCGAATTACTGAGACAATGGATGGATCATCATGGTTGGTATGAC
AGAAAGAGTAAAGAAAAGCCATTCAACAGAATAGAAGACATCATCTTCATTAGTGCTATG
GGTCCTCCAGGTGGTGGAAGAAGTGAAATTACATAAAGACTTTAGAGACACTTCAATATT
ATGACTTATACAGATGTGCAATAAGAATCTATTCATACTATCTTCTACACAATTATCACT
GCTTTCTATTACAACTTTTCTCAAGATGTTAAGAACAGTTTGAACAACTTAGTAGAAATG
ACTCTCAGAGTATATGATAACGTACTATATGGAAGATTAAAGCCAACCCCAAACAAATCT
CATTACACTTTCAATTTGAGAGATATTAGTAGAATTTTCCAGGGTTTGTGTAATGCCAAC
AACAAGCTTTCTCCAATGCCAGTTCATGTCGTAAGAATGTGGATACATGAAAATAAGAGA
GTCTTTGGAGATAGACTCATTGACAACTCTGATAGAGATTGGCTTGATAGCATTCTACTC
CAAGAGGCTGAAACTACTTTCTCATTGACCCATAAAGAGATCTTTAATTCAGAAAGACTC
ATTTTTGGAGATTATATGGGAGGAATAGATGTAGATAACAGAATTTACGCTTAAGTAGAG
AATCTCAAAGACTTTGTCACAAAGATTGAAGATTATTTGGAGGATTATAATTCAGCTGTT
AAGACCCAAATGAGATTGGTCATGTTCTTGGATGCATGTGATCATGTCTCTAGAATTGAG
AGAGTTATCAGACAACCACTTGGTAATTCTTTATGTCTTGGAGTGGGTGGTTCAGGTAGA
CAATCTCTTGCCAGACTAGCCACTTTTATTGCAAACTACAAAATCTTCCAAATTGAAGTC
GTAAAAGGCTATAACATGTAAAATTGGAGAGAAGATGTTAAAAAGGCACTTATGCAGGCT
GGTGTTGACAATAAATCCACCTCCTTCCTCTTCGTTGATACTCAAATCATTAATGAATAG
ATGTTAGAAGATATCAATAACATTCTAAACTCTGGAGATGTGCCAAGTTTGTATAAAACA
GAAGATTTTGAACCCATCTATAAAGTTGGCAAACTTGTTTGTATGGAGAAAAATCTTTAA
ATCACAAAGATGAATATGTTCTCTGGATATTTGGGAAGAGTCAAGAGAAACATTCACATG
ATTATTGCTATGTCACCTCTTGGTGAAATCTTTAGAAGTAGAATAAGAAAATTCCCTTCA
CTAGTCAACTGTTGCACTATCGATTGGTTCACAGAATGGCCAGAAGAAGCCTTGCTAGGT
GTCGGTAGAGGTCAAGTTACAGCTGAAGATCTTGGACTTGGTAAATTCCTAGAGCCTTGC
GTAGAGATGTTCAAAAACATCCATCAATCTGTAGAAAAGAAATCCGCTCAATTCTTGGAT
TAACTTAGAAGAAGAAACTATGTTACACCCACTTCTTTCCTTGAGCTTTTGAGCATGTAC
AAGACTATTCTCTTCGACAAGAGAAAGGAAGTCGAGTTCCAAAAGAACAGATTATTGAAA
GGTCTTCAGGTGCTTGAAGAAGCTGCTATCGAAATTGCAAAGCTTAAAGAACACATTGAT
AAAATGACTCCAGAACTAGAGATAACAAAGAAGGATGTCGAAAAGACAATGCATGAACTT
TCTCACGATAAAGCAGATGCCGATTAAGAAAAGGAAATTGTGGCTAAGGATGAAGCAGAA
GCTACTTAACAAGAAGCAGAGGCTGAAATGTTGAAAACTGAGGCTGAGTTTGAATTGAGT
AAAGCCACTCCTCTTTTAGAAGAGGCTTCCAGAGTTCTTAAAGAACTTAAGAAAGACGAT
TTCTATGTTATGAGTTCTATTAAGAAGCCTACTTCAGCTGTCGTCCTTGGTATGGAGATT
TCATGTTACATGATGGGACTTAAAGCTAAGAAGACAAATATTGGAAAAGTTGATGGTGAC
ACTAATGGTTACTTCGATCTTGCCAGATCTAATCTCTTGAATAATCCAGGACAGTTTATG
TAGAAGATGATTGACTTTGATAAGGAAAATATTCCAGAGGGAACAGTAAAGAGAGTTAAT
GCTATCTTAAACTCAGAGGACTTCACTTTAGATAAGGTCAAGGCAGCCTCATAAGCCTTG
GTCGCTATCCACAAGTGGGTATCAGCTATGATGCAATATCACGAGTTGTTGAAAATTGTT
AATCCAAAGAGACTTAAGGTGTCAGAAATGAACGAGAAACTTTCAATCGTTAGAGCTAAT
TTAGCTGAAAAGAGAAAGAAGCTTAGAGAAGTAGAAGAAAAGATTGAGAGTCTAGAAAGA
ATGTACAGAGAGAAGCTTGAACTTGAAGCAAGTTTACAACAATAAATCAATGACTGTTAC
AAGAAATTAGACAGAGCAAACAAGATCATTTCTGGTCTAGAAGGTGAGAAGACCAGATGG
ACTTAAACTGTAGGAAGATTAGATAGAGAGTATGGTCTTTTGATTGGTAACTGTTTAATC
GCAGCAGGTATGGTCGCTTATGCAGGAGCTTTCACAGCTTAATTCAGAACAGATCTTGAG
GCTTAATGGAGAGAAGGTATCAAGAAACTTAAGATTGATTATATGGAAGGCATAACAATG
AAAGCTTTGCTTGAAGATCCAGTTAAAACAAAGATATGGACTGCAGCTTCTCTTCCTAAT
GACAACCTTTCAATTGAAAATGGTATTATTATGTTCAAGTCGAGAAGATGGCCACTTATG
ATTGACCCTCAAAATCAAGCCAATAAGTTTATCAAGAGTTTAGGAAAAGACGAGGCTGAT
TCAGGACTTGATGTATTTAAGATGAGTGATTCTTAAATTCTAAAGTTCCTTGAGTTGGGT
ATCCAATTCGGTAAATGGGTGCTAATTGAAAATGTTGGTGAAGAAATGGATCCAGCACTT
GAACCAATCTTACTCAAATAAATAGACAAGAGCGGAAGTCTTAAGCTTGGAGATAAGAGT
ATCCCTTACAACAATAGTTTCAGATTTTTCATGACTACTACTATTCCAAATCCTCACTAC
TCTCCAGAGACATCAGTCAAGGTTACAATTTTGAATTTCGCTATTACTCCTTTCGGTCTT
GAAGAGCAGATGCTCAACTAGTTCGTATCTTAAGAAATGCCAGAACTTCAAAAGAAGAAA
GATACAATTGTGCAACAAAATGCATAATCAGCTAAGGTATTAAGAGAAATTGAAGATAAA
ATTCTAGAAGGATTGACAAAGAACGCAAAGATTGCTGATATTTTAGAAGATGATGAGCTT
ATTAAGGTGCTTGATGAATCAAAGAAGACATCAGATGAAATTACTTAAAGAATGAAAGAA
TCAGAGATCACCGAAAAAGAAATTGATAAGACAAGAGAAATTTACAGACCAGTCGCTTAT
AGAGCTTCAATTCTTTTCTTCACGATTATTGATCTGGCGTTTGTTGATCCTATGTATTAA
TACTCACTGTAATGGTTTGCTAATCTATTTGGTTAATCAGTAGATAACTCGCAAAAATCA
AACGAAGCTGATCATAGAATCAAATTCTTAAATGATCATTTCACTCTAAGTTTATATGAA
AACATTTGCAGAAGTTTGTTTGAAAAGCATAAGTTGCTATTCTCATTCATCTTAACTGTC
AAGATCCTCTTCGGTTATAACGAAATTGATCATGAAGAGTGGAGATACTACTTAGCTGGT
CCATCTGGAGAAATTGAGATAGCTAAAAATCCCACAGATTGGTTGGGTGAGTTAGAGTGG
GCTGAAACCTACAAACAATTATTCGCAATGTCAAAGCTCCCCGTTTTCAAAGGCTTTGAC
AATTTCTTCATTTAAAACAACAAGGCTTTCTAAAAGATATTTGATCATCAAGAGCCTCAC
AACCAGCCAATTCCAGGAGATTGGAACAAAAAGTTGAACTCATTGCAAAAGATGATCGTC
CTCAAATCAATTAGACCAGATAAGATTACTCTTGCAGTTCAAAATTATATTGTTGAAAAA
CTTGGAAGAGAGTTTATTGAACCACCAACCTTTAACTTATCTAAGAGTTTCAAGGACTCT
TCAGTTACTATTCCACTTATTTTCGTGTTGAGTCCAGGTTCTGATCCAGTTGCCGATTTC
CATAGATTCGCTGAGGAGATGAATATGTCAAAGAAGCTTGAGAGTATCTCACTTGGAAAA
GGTTAAGACAAGAAAGCTGAAAATATGATTTAAGACTGTGCAACAAGAGGAGGTTGGGTC
TTACTCATGAACTGCCATTTGGCCACATCTTTCATGCCTAAGTTGGAACACATCGTTGAA
AATCTTGATGACAGCAATCACAGAGATTTCAGATTGTGGTTAACAAGTATGCCCAACAAA
GACTTCCCAGTCTCTACCCTATAAAACTCAGTCAAGATGACATTAGAGCCACCAAGCGGT
CTCAGACAAAATATCTTGAGAACTTATGAAGCTATTGATGGTAAAGATTTTGAAGATTGC
ACTAAGCCAGAAATTTATAAGAAATTGCTATTTGGATTCTCATTCTTCCATGCAATTGTC
CAAGATAGAAGAAAGTTTGGAGCTATTGGTTGGAACATCCCTTATGAGTTCACTAATGAA
GATTTGACTGTATCTCGTAGACAATTGAAGATCTTCGTCCAAGACTATGAGCTTATTCCT
TATAAGGTGCTCAATTACATTGGAGCTGAAATTAACTATGGAGGTCGTGTCACAGATGAT
AAAGATTCAAGATTGATTATCACTATTCTAAGAACATATGTGAACGATGGCATTCTACAG
GATGGTTTCAAGTTTTCCACTTCAGGTATCTATTACAGTCCCGCCTGCGGGGAGAAGGAA
GATTATATCGAGTACATCAAGTCACTTCCATTGAATCCATCACCAGAGGCATTTGGTCTT
CACGAGAATGCTGAAATTACCACATCATAAAATACAACCAGAGTGTTGCTTGAAGCTATT
TTATCCATGCAACCAAGAGCATCTAGTGGCTCTGGAAAAACAAGAGAGCAAATCATTGGC
GAGATGGCACAGTACTTAGAATCAAGAACTCCAGAAGTATTTGATCTTGAACAGGTTGGC
AAAAAGTATCCAACTTCCTATGAAGAGTCTATGAATACTGTACTATTCCAAGAATGCGTC
AGATACAATAGATTATTGCAAGACATGGCAATTAGTTTGGCGAATGTACAAAAAGCTCTA
AAGGGAGAAGTAGTTATGAGTGAGGAACTTGAGAAAATGTCCAACTCTATCTTTGATAAC
TTAGTCCCTAAGAATTGGTAAGACAAGGGTTTCTTGTCTCTAAAACCTCTTGCATCTTGG
ATCCAAGATTGTAACGATCGTATTAAATTCTTAACAGACTGGATTAATCATGGTACTCCA
AAAGTGTTCTGGATATCAGGATTCTTCTTCCCACAAGCCTTCTTAACTGGTACTTTGCAA
AATTATGCTCGTAAACATATCATCGCTATTGATCGTTTGGCTTTCCGTTATGAAATTCAT
GATGATAAGACTTATAAAGACATTAGGGAGAAGCCAGCAGATGGTTGCATCATTTACGGT
ATGTATATTGAAGGATGCAAATGGGACAGCAGAAAGCATCAGCTTGGTGATTCAGACCCC
AAGAAACTGTTCACAGATATCCCTCTTATTCTTCTCGTACCTCAAATGGACAGAGTTGCA
CCAAAATCCGGCATTTACAACACTCCAGTCTACAAAGTGCTGTCAAGAGCAGGTACTCTA
TCTACCACAGGTCACTCAACCAACTTCGTTATGATGATGGAGCTGCCCTCCGACGAGAAA
GAAGACAAGTGGATCAAGGCAGGTGTCGCAGCCTTCCTAGCACTGAGATATTGA


>Contig15709.0.g85(protein)
MQGAAGDIPKQRGIYSEILTTEDTENLKLVSTIGPSANNVIHSNVKQKMPRALGIKRKPQ
PIVEVVANKEQKVANAFLEKSGIILGKNYFRDANVNLGFYSKKREGVADVDPKVMEPFIP
IPGKPPRQVVIDRQRKLFASLSIEELLLELGIDYSNPQKNQADWLPLEPFDDTEYDCRLP
EEWLEYGKDVVTGKFAPIPGKGLWYDDEGRGHWRSVLIHSYDQDRNNYTGTWDDDQNGYC
ELTRINLLFNAEDPRIFAQRVAQAHQERIYADSQIRYNFFIDNMPTSSELPELDSEQQHR
ILQMATASRYLKQRGSVETSSILQEVNLDFGRTMNWIIMDKTMEKPIEQLKEMIPANLTL
PPKAPLRDTPYFGMTPIPQHDFPEQFSNFCFNSLYIKEEVIKAMVEIRAECNQLLQDNKI
FDVSINKTLRVEEFKQIQSSSVAQIRFNTRETGWVGRLEKIIKASFTEVGKGWFNIHETS
KETYEFGKLKKFLTLINFMMQDTILTMCKDSVKQFVLFMVQFIPRETLILSTSEVKNTFE
KIQIEAEEEEQIEEEDIPESEMTTIQLVKKEINKMFDKNKDPEPLFVLDLILKPNQLIPQ
YSTDPKEIVAKIMEVFDEGIECLQQIPQLEPILLRHLFKTHGKKMLKAPLRPREEPKRKP
DDTNNKKFLPDENIWLWDSYFAIRKGLEKSIEPLYEYVKTFTKFEGENKLNPDRYVRSLD
EGETPITAEGLKHNIEEHRKEEQRLKDDIPESIVVSIFQVNCKDIRNMYVGKHSSIIDKE
IKLIAQKAKDTNYTLSTKFDEINERIRRPPKNIEDLTETRKYISEIPVEIEKLKKSINEC
MGIYNILDEFNYEFSNTENDQKWWLFGSPQKVVSVIDSQSQILEKQKENFVKAMEAEQEE
FEETLNNLEITVGGFHAFDDLNRYEEIAVDVESVNSRLQDCIEQSRLYNQREFLVGKDQK
DYTRLQQMAKEFQPYSNLWLTTRNWFKSHHSWLNDSWEDLNAVELDNTFDQSNKTLSAVL
RYFRDKDFPKITKIAETMKKNIDDFKPYVPLAVALRKDGMKERHWDQISDKVKFDIRPVE
GFTLTSVIEAGMLKHIDVCEEVGEKAYKEYHIERSLNKMVGDWKECNFLLPQFKQTTTNY
IAGFDDAITMLDEHIVTTQAMTFSPFKKPFEKEIEEWNTKMILVSDTLEEWVKCQSQWMY
LQPIFDSPDIMKQLPQETKRFKSVDSTWRHIITQTKQAPNILMTCSKEGLKEKFQEANKN
LEIVQKGLADYLEKKRSVFARFYFLSNDELLEILSQTKEVRNVRPHLRKVFEAMADLEFK
DDDTIWAMFSGEGEKVNFVKKIDPKDRNVEYWMGDVEKMMQLSVRNVLLKSIEDYVVRPR
NDWVQQHPGQCVLNGSQVHWTTEVEEAIRTKGVQGIQEYLDNLNKQLIDTVVLVRQKLTK
NATITINALIVIDVHAKDVVAKLVEEKVEDVNAFEWISQLRYYWENDDCYVKCVQTNFPY
GYEYLGNSLRLVITPLTDKCYMTLMGALNLNLGGAPAGPAGTGKTESTKDLAKALAKQCV
VFNCSDGMDHIMVAKFFKGLASAGAWACFDEFNRINIEVLSVIAQQLLVLFRAKANNDPE
IIFEESLIKMKPTFCVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIGEIMLYSFG
FLTGRDLARKMVTTFKLSSEQLSSQDHYDYGMRAVRSVINAAGLLKRANPDMNEDQLLLR
ALRDVNVPKFLKDDLPLFENIILDLFPGVDKPQVNYGGLFGSLNNSCAHFNLQPVDQFIM
KIIQLYDTIQVRHGLMLVGPTGGGKTANYKILQHAMSALSGQDSFVKVHVDILNPKSITM
GQLYGYVDAQTSEWQDGVLAKLVLECTKDESPDLHWVMFDGPVDAIWIENMNTVLDDNKK
LCLNSGQIITLTSRMTMMFEVEDLAVASPATVSRCGMVYMEPASLTLEPLVISWLNSLPV
KIKENKNIVNRLQFLYDNFLNDTCYYMRKNLTEPVKTVDNNITQSSMRILECFFANYVES
EIKKVPKEEIANLESMITQLFIFAIIWSIGCTSTLDGRMKFNSWFRERMQTLQIDFPEEK
LVFDYKFNLETKEWQYWKDTISEYNVDIKVSYNEILVPTVDSIRMKFLTKFLVMNGKHVL
TPGPTGTGKSVNIQELMTYELPEEFQTLAMTFSAQTSANQTQDYLDDKFEKRRKGVYGPP
VGKKFVIFIDDMNMPKKEEYGAQPPLELLRQWMDHHGWYDRKSKEKPFNRIEDIIFISAM
GPPGGGRSEITQRLQRHFNIMTYTDVQQESIHTIFYTIITAFYYNFSQDVKNSLNNLVEM
TLRVYDNVLYGRLKPTPNKSHYTFNLRDISRIFQGLCNANNKLSPMPVHVVRMWIHENKR
VFGDRLIDNSDRDWLDSILLQEAETTFSLTHKEIFNSERLIFGDYMGGIDVDNRIYAQVE
NLKDFVTKIEDYLEDYNSAVKTQMRLVMFLDACDHVSRIERVIRQPLGNSLCLGVGGSGR
QSLARLATFIANYKIFQIEVVKGYNMQNWREDVKKALMQAGVDNKSTSFLFVDTQIINEQ
MLEDINNILNSGDVPSLYKTEDFEPIYKVGKLVCMEKNLQITKMNMFSGYLGRVKRNIHM
IIAMSPLGEIFRSRIRKFPSLVNCCTIDWFTEWPEEALLGVGRGQVTAEDLGLGKFLEPC
VEMFKNIHQSVEKKSAQFLDQLRRRNYVTPTSFLELLSMYKTILFDKRKEVEFQKNRLLK
GLQVLEEAAIEIAKLKEHIDKMTPELEITKKDVEKTMHELSHDKADADQEKEIVAKDEAE
ATQQEAEAEMLKTEAEFELSKATPLLEEASRVLKELKKDDFYVMSSIKKPTSAVVLGMEI
SCYMMGLKAKKTNIGKVDGDTNGYFDLARSNLLNNPGQFMQKMIDFDKENIPEGTVKRVN
AILNSEDFTLDKVKAASQALVAIHKWVSAMMQYHELLKIVNPKRLKVSEMNEKLSIVRAN
LAEKRKKLREVEEKIESLERMYREKLELEASLQQQINDCYKKLDRANKIISGLEGEKTRW
TQTVGRLDREYGLLIGNCLIAAGMVAYAGAFTAQFRTDLEAQWREGIKKLKIDYMEGITM
KALLEDPVKTKIWTAASLPNDNLSIENGIIMFKSRRWPLMIDPQNQANKFIKSLGKDEAD
SGLDVFKMSDSQILKFLELGIQFGKWVLIENVGEEMDPALEPILLKQIDKSGSLKLGDKS
IPYNNSFRFFMTTTIPNPHYSPETSVKVTILNFAITPFGLEEQMLNQFVSQEMPELQKKK
DTIVQQNAQSAKVLREIEDKILEGLTKNAKIADILEDDELIKVLDESKKTSDEITQRMKE
SEITEKEIDKTREIYRPVAYRASILFFTIIDLAFVDPMYQYSLQWFANLFGQSVDNSQKS
NEADHRIKFLNDHFTLSLYENICRSLFEKHKLLFSFILTVKILFGYNEIDHEEWRYYLAG
PSGEIEIAKNPTDWLGELEWAETYKQLFAMSKLPVFKGFDNFFIQNNKAFQKIFDHQEPH
NQPIPGDWNKKLNSLQKMIVLKSIRPDKITLAVQNYIVEKLGREFIEPPTFNLSKSFKDS
SVTIPLIFVLSPGSDPVADFHRFAEEMNMSKKLESISLGKGQDKKAENMIQDCATRGGWV
LLMNCHLATSFMPKLEHIVENLDDSNHRDFRLWLTSMPNKDFPVSTLQNSVKMTLEPPSG
LRQNILRTYEAIDGKDFEDCTKPEIYKKLLFGFSFFHAIVQDRRKFGAIGWNIPYEFTNE
DLTVSRRQLKIFVQDYELIPYKVLNYIGAEINYGGRVTDDKDSRLIITILRTYVNDGILQ
DGFKFSTSGIYYSPACGEKEDYIEYIKSLPLNPSPEAFGLHENAEITTSQNTTRVLLEAI
LSMQPRASSGSGKTREQIIGEMAQYLESRTPEVFDLEQVGKKYPTSYEESMNTVLFQECV
RYNRLLQDMAISLANVQKALKGEVVMSEELEKMSNSIFDNLVPKNWQDKGFLSLKPLASW
IQDCNDRIKFLTDWINHGTPKVFWISGFFFPQAFLTGTLQNYARKHIIAIDRLAFRYEIH
DDKTYKDIREKPADGCIIYGMYIEGCKWDSRKHQLGDSDPKKLFTDIPLILLVPQMDRVA
PKSGIYNTPVYKVLSRAGTLSTTGHSTNFVMMMELPSDEKEDKWIKAGVAAFLALRY