Identifiers and Description

Gene Model Identifier

Contig15497.0.g44

Standard Name

None

Aliases

Contig15497_0_g44

Description

Glutathione peroxidase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000461107.002264059090237e-38Glutathione peroxidase family
protein
SGDYIR037W9.996273942859018e-26HYR1 SGDID:S000001476, Chr IX
from 423128-423619, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15497.0.g44(coding)
ATGGGAGGCCTAGTTGCCACACTTTGCTATAAGAAAGGCCGTGATTAAGAACTATCAACT
CCTTTCAAATCTCTCTTTGATATACCTGCTGTTGATATAAACGGGAATCAGATTCAAAAA
CTTGGGAATATTTTAGAATATAAAAGTTGCATCTTGGTTGTAAATGTAGCATCTAATGAC
AAAGGTTTTGAAATATTGGCATTCCCTTGCAATTAGTTTATGAGATAAGAACCTAGGAGC
AATTAAGAAATAAAGGAGTATGTCATTAAGCGCTTTGGAGTATAATTTCCACTTTTTGAA
AAATGCGATGTCAATGGACCTAATGCTCATGAAGTTTTCAAGTTTCTCAGGTACAATATG
CCATAGCTAAATAAGAAAAATAAAAAAGGAGTTAAAGAAGTGCCCTGGAATTTCTCCAAG
TTTCTAGTAAATAAATAAGGAAAAGTAGTAAAATTTTAGGATCCAAGAACCAGCATCTTC
GAAATGAGAGACGATATTGAAAGATTGCTTCAAGAATGA


>Contig15497.0.g44(protein)
MGGLVATLCYKKGRDQELSTPFKSLFDIPAVDINGNQIQKLGNILEYKSCILVVNVASND
KGFEILAFPCNQFMRQEPRSNQEIKEYVIKRFGVQFPLFEKCDVNGPNAHEVFKFLRYNM
PQLNKKNKKGVKEVPWNFSKFLVNKQGKVVKFQDPRTSIFEMRDDIERLLQE