Identifiers and Description

Gene Model Identifier

Contig15140.0.g49

Standard Name

None

Aliases

Contig15140_0_g49

Description

Endonuclease/Exonuclease/phosphatase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03372 ) Endonuclease/Exonuclease/phosphatase family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004274906.999507172836373e-51Endonuclease/Exonuclease/phosp
hatase family p...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15140.0.g49(coding)
ATGGAATCTAACAAGAGTAATAAGCCACTTAGTATAAATGTGGACATGATTTAATTTGGG
CAGCCCGAACTAGTTACTGATGAAATTTAAACAGATTTGCCTTATGACAAAATCATTGAT
AACTAGCCAGTAATTGATCTAAGTCATGCCAAAGAGAATAAAGTCATTTACATTCTTTCA
TAACAAAGAAAGTAATAAATAGAGAAAGCAAAAAAGATCATTAAAAGTAAACATATACCA
ATACCACATGATTTTGATTTTTCTGAGGATAAATCGGTACTTAAGGAAATAAACACTTTG
GGATTCGGTGCTTTAGGTGAGAAATTTTTCTGGAAAAGAGTGCCAAACAATTTGCCTTTT
AACACAGTCAAAGTACTAGATTAAAATACAGGGAATAATGTTTAAGATAAAGTATAAAAT
ATCACAATGATTACTTACAATATTTGGTTTGAAAGTTTCTATCGAAAAGAAAGATATGCT
GTGATATTGAAAATTTTAGAGAAATCTAAGGCGGACTTTGTATGTCTGTAAGAAGTAATC
TATGATTTCTAGGTCATGCTTTTTAATGAAAAATGGGTACGAGAAAGATATTTCGTTAGT
GAAATGGATATCACGGGAGGTTATGGTGTATTGATTCTGTCTAAATGGCCATGTAGATTT
TATGAGATGGCTTTTCCTGGTAGAATGGGGAGAAGTCTGCTATTAGCTGAGTGCTAAATT
AATGATTAACCTGTCATTGTAGCCACTTCTCATTTTGAGAGTCTAAACAATTAAGAAATT
AGAAAACAATAACTAGAGATTGCTTAGCCATTAGTAAGCTTAGTAGATAATGGATTTTTA
ATGGGTGACTTTAACTTTGATTCTTCGTGGAGAAGTGAATAAGCAAATATAGATAAAGAG
TTTGAAGATATATACTTGACATTAAACTAAGGAGTAGAGTCATTTACTATGCCAAAGACT
CCAGAATTTCCATAGTGGAGGCCAGATAAAATCTTAGTCAAGAAATCCTCAAAATGGCAG
CCAAAATCTATTGACATCATTGGGAGGTTCCCCATTCCTAGCTTTAGTCAAGAGGATCCA
TTATAGATTAAAGTCGACTAAAAAGTTAGAACTCCCTCAGATCATTATGCACTTTTTACA
GAATTTGAATTTCAAACTTAATGA


>Contig15140.0.g49(protein)
MESNKSNKPLSINVDMIQFGQPELVTDEIQTDLPYDKIIDNQPVIDLSHAKENKVIYILS
QQRKQQIEKAKKIIKSKHIPIPHDFDFSEDKSVLKEINTLGFGALGEKFFWKRVPNNLPF
NTVKVLDQNTGNNVQDKVQNITMITYNIWFESFYRKERYAVILKILEKSKADFVCLQEVI
YDFQVMLFNEKWVRERYFVSEMDITGGYGVLILSKWPCRFYEMAFPGRMGRSLLLAECQI
NDQPVIVATSHFESLNNQEIRKQQLEIAQPLVSLVDNGFLMGDFNFDSSWRSEQANIDKE
FEDIYLTLNQGVESFTMPKTPEFPQWRPDKILVKKSSKWQPKSIDIIGRFPIPSFSQEDP
LQIKVDQKVRTPSDHYALFTEFEFQTQ