Identifiers and Description

Gene Model Identifier

Contig14985.0.g5

Standard Name

None

Aliases

Contig14985_0_g5

Description

SET domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002569503.998479955315009e-46SET domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14985.0.g5(coding)
ATGAGTGCTAGATCAACTAAAAATCAAACTTAGTAAACAAAGCAGGAGCAACCTATTCAA
ACTACTATCTTGCAGTAATAACCAATTAATTTGAGCAGGAAAAGGTCAAGAGCATAATTC
AGAGAGCAACCAAAATAAGATAAAATTAAGAATGCCAATGAATTGTTTGAATTTGATGTA
CCTGAACCACTTATAAAATAAACTAAAATAGTCAGATCAAAGAGATAAGTAGCCAAGATT
AATGAAACTTATTCTATTAGTAAAGCGATAGATTAAGACAATTCAATCAAGCAAAGAGCT
AAATCTATGGGTGGTGAGAAGAAACTAAAAGAATAATCTAATTAACCAGTGACATTGACA
AAGCAAAGTAACTTACAAAGTTTCTTTAAGCTTGGCAAGAAATGTAAAAATCTGAAGTGT
GAGAAATAAACTCCTTCTAAGTTTGAAGATTTGATCAAATGTGAGGTTTGCAGTGACAAC
TATCACTGGTAGTGCTCACAGTAGTTCTAAGAAACACCTACATAAGAAGATGAATTTATT
TGTACTAGTTGTTAGATGTAGCTCAAAGAAACCAAAAGACTAAAATAAAATTACCAGAAA
GAAGAAAACAAGGAAGTTTAGTGTTCATAGTGCAAGAAATAATTGAAAAGTGAAGATAAT
AGATAATAATGTTTAAAATGCCAGAATAACTATCACTAAAAGTGCTTTGAGAAGTTTGAA
GATGAAATGTTTTGTTTGAAATGCTAAAAACAGTTATAGTAAGGTAAAACTCAACTTATC
CCAGAAATGAAAGTTCCGTTAATCACTATGATCTCAAATCATGCAAGCAAAAATACCTCG
AAATAGACTAAAAACTAATCTTTGACTAGTTTCTTTAATCAAACGAAGAAGAAGCTACCT
GAAACCAATTACTTTGCTGATATTCTTAAGAAAGATGATACTCCCTAATCATAACTGATT
AATCAGTTTTACTCTTAAGATTTAATGAAGAAGTAAAATAGAAAGAAGTCTGTTTCACTT
ACAAGAAAGAAGAATATTTTCAAACTCTCAAAGCTGATTGATGATCCACTTACTGAACAT
GAAATACGTCAGTCCTTTGAAAGAGCATTCTTTGCTAAAGACTTAACTTATGCTAATAAA
TAAATATATGATGATCCTTTGTGCCTGGAGTCTAAGAATAACATCAACTTAGAGCCTAAT
GTTCAAAAATTAGTGAAAGAAAATATTGAATCCGTGTAGTAGCTAAGAAGAAGAGAAGAG
TTAGGAATTCTGCCTCCATTGATCTTGAAACATGATTAGAATTAAGGTTTCTATGTTGAA
GCTGCTCAAGATCTCCAAGATTTAACATTACTATGTGAGTATGCAGGAGAAGTGCGAACT
TTGAGATAAACAATATTTGATAAAAATGATTCAATTATGGAGTTACTAGATACTGGAGAC
TCTGATACTTCACTAGTAATCGCACCACAAAAGTATAGTAACGTAGGTAGATTCTTCAAC
TCAATCAATAAAAGTAGCAAAGAGTCAAAGAAAAAGCAAAATATCAGGAGTATAAGATGC
TAGATAGATGGAAAAGCAACCGTTATGATATACACTCAAAGGAATGTCAAGAAAGGAGAG
TAGCTACTATATGACTATAACGAGGCTAAAAATATGTACCCTACTGATGATTTTGTTTGA


>Contig14985.0.g5(protein)
MSARSTKNQTQQTKQEQPIQTTILQQQPINLSRKRSRAQFREQPKQDKIKNANELFEFDV
PEPLIKQTKIVRSKRQVAKINETYSISKAIDQDNSIKQRAKSMGGEKKLKEQSNQPVTLT
KQSNLQSFFKLGKKCKNLKCEKQTPSKFEDLIKCEVCSDNYHWQCSQQFQETPTQEDEFI
CTSCQMQLKETKRLKQNYQKEENKEVQCSQCKKQLKSEDNRQQCLKCQNNYHQKCFEKFE
DEMFCLKCQKQLQQGKTQLIPEMKVPLITMISNHASKNTSKQTKNQSLTSFFNQTKKKLP
ETNYFADILKKDDTPQSQLINQFYSQDLMKKQNRKKSVSLTRKKNIFKLSKLIDDPLTEH
EIRQSFERAFFAKDLTYANKQIYDDPLCLESKNNINLEPNVQKLVKENIESVQQLRRREE
LGILPPLILKHDQNQGFYVEAAQDLQDLTLLCEYAGEVRTLRQTIFDKNDSIMELLDTGD
SDTSLVIAPQKYSNVGRFFNSINKSSKESKKKQNIRSIRCQIDGKATVMIYTQRNVKKGE
QLLYDYNEAKNMYPTDDFV