Identifiers and Description

Gene Model Identifier

Contig14975.0.g34

Standard Name

None

Aliases

Contig14975_0_g34

Description

Autophagy protein Apg5

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004940302.0004286606204839e-16hypothetical protein
SGDYPL149W0.00000000002000577768187062ATG5 SGDID:S000006070, Chr XVI
from 271310-272194, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14975.0.g34(coding)
ATGGCAGAAGATTTGAGTAAAACTTAAATTGTAGGGGGGAACTCGTCACAAGCTAGTCTG
ATAGGTAATGGCATCCAATAACAACCATTAGCCCAATCAACATTTATCAACACTCAACCA
ATCCCAACAAAGAATTAAATTCCCTCAGACGCTGTAAATATGGAACTCAGAAGGAAACTA
TGGGAGGGCTCTATCCCTGTTAAAATTGATTTATCCCTCAAAGACTTGCAGAGTATTGAT
CCACCCAGGAGTCTATATATAATGGCACCAAGATTGAATTATTTGTTCTACTTACTCTCA
GAAGTGAAAAAAATGTTTGATTCTTATGCCAGCTCAGATAAAATTGATTGTTATGACGAG
ATGTGGTTTTCCTTTAATGGAACTCCTCTAAAATGGAATATACCACTTGGTGTTTAATTT
GATACATTAGTGGGTTTAAAAAATAAACAAAAAGATTTGCCCTGGTGTTTAACTTTTCAC
TACAGAGACTTCCCTGAAGAGCAAGTTTTGAGACTTGAGGGATTGAATTTTTTCAAATTT
CACTATATTAATGCTTTGAAAGAATCGCATAATATCAGGATGGGCTAGGGTTCAGAAATT
CTGAATATGTAGAATCGTGATGAAACACGCATGATTGAAGGAATTCTTAAACATAACTAT
GAGTCATTCTGGGAAGTAAACCAACCACTAATTGACAAAAACGTATAAGAATTGAAGAAG
TACTCTCTTAGAATCTTTTCAAACACCCATCATACTTACCTTCTTGCTAATTTAGATGTT
AATCCCACTGATTAGAACAGTGATGAAGGATAGAGACAACCTGAGCAATTTACGATTGGC
GACGCATTAGAATAAACATTCCCAAGATTGTTTGAGAGAAGTCTCAATGATAATGGCGAT
TTGGATTTACTAAAAAAGAGGGACTTTGAGATCGTGTGCTAAGGTGTGGAAGTTGATATG
AACACCCCTCTCTACTGGATGCAACTAAATATGAGTCATTTGGATAACTTCTTATACATA
AGCTTCAAATTTGACACTAATAACACTGGCTGA


>Contig14975.0.g34(protein)
MAEDLSKTQIVGGNSSQASLIGNGIQQQPLAQSTFINTQPIPTKNQIPSDAVNMELRRKL
WEGSIPVKIDLSLKDLQSIDPPRSLYIMAPRLNYLFYLLSEVKKMFDSYASSDKIDCYDE
MWFSFNGTPLKWNIPLGVQFDTLVGLKNKQKDLPWCLTFHYRDFPEEQVLRLEGLNFFKF
HYINALKESHNIRMGQGSEILNMQNRDETRMIEGILKHNYESFWEVNQPLIDKNVQELKK
YSLRIFSNTHHTYLLANLDVNPTDQNSDEGQRQPEQFTIGDALEQTFPRLFERSLNDNGD
LDLLKKRDFEIVCQGVEVDMNTPLYWMQLNMSHLDNFLYISFKFDTNNTG