Identifiers and Description

Gene Model Identifier

Contig14897.0.1.g59

Standard Name

None

Aliases

Contig14897_0_1_g59

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam00659 ) POLO box duplicated region
  • ( pfam06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family
  • ( pfam01636 ) Phosphotransferase enzyme family
  • ( pfam10200 ) NADH:ubiquinone oxidoreductase, NDUFS5-15kDa

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001917909.997093137033517e-262Protein kinase domain containi
ng protein
SGDYMR001C2.0008734984431652e-95CDC5 SGDID:S000004603, Chr XII
I from 271136-269019, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14897.0.1.g59(coding)
ATGTCATAAAAACCATAGAGTTCCCGCAGCAAGGATAATTTGTAGCAGGATAATAATGCA
CAAATTATTGTAGAAGAAAAAGTTGTAAAGTTCAATGGAGATGTTTGCATCAAGAAATAT
CTGAGAGGCAAGTTTTTGGGAAAAGGAGGTTTCGCTAAATGTTACGAGTTCACAAACTTA
GAAACCAAAAGACTATCTGCAGCCAAGGTTATTGCAAAGACCTCACTTACCAAGTCAAGA
GCCAAGCAAAAGCTTATGAGTGAAATTAAAATTCATAGAAGTTTGCATCACAACAATATT
GTCGGCTTCGAGCACTTTTTTGAGGATGCTGAAAATGTTTATATCTTGCTCGAATTGTGC
CACAATTAGTCTCTAAATGAACTATTGAGAAGAAGAAAGAGGCTCCACGAGCTCGAAGCT
TAATGCTACGTAAATTAGATTTGCGCAGCTGTAAAGTATCTTCATAGTCACAGAGTAATT
CACAGAGATCTTAAATTAGGAAATCTTTTCTTGAATGACAAAATGGAGATCAAAATTGGA
GATTTTGGACTGGCAACTAAGCTCGAGTTCGATGGCGAAAGAAAGAGAACTATTTGTGGT
ACTCCAAACTATATCGCACCAGAAGTGTTGGAGGGTAAGTAAGGTCATTCTTATGAGGTC
GATATCTGGTCTCTTGGAGTAATAATTTATACTCTGATTATTGGAAAGCCCCCCTTTGAA
ACCTCAGACGTCAAGACTACTTACAAGAGAATTAGAATGAACGCTTATTCTTTCCCTGAA
AATGTTCCAATTTCAGATGCAGCAAGAGACCTCATTACTAAAATTCTCAACAATGATCCA
TCTAAAAGACCTACTGTTGATGATATCTTAAATCATGAGTTCATCAGTAATGGTGGTACT
ATCCCAAGACTACTTCCAGCTTCAACTCTAGCTTGTCCACCTTCGTCAACATACATCCGT
CAGTTCTTACCTCAAAGTCAAAATTAAAATGGTAAGAATAGTACTGGATAACAACAACTT
ACAAATACTGCACCAATTAAAAGCAACGACTTGATTTCAGGAAGAGACAAGAAAAATGCA
ACAGATAGGCTTTCTGCTCAACCAATAGGAAGTAAGCCAATCAGCAAAGATGTCAACAGA
CCTTACACTGATTAATTAGAGACAGAAGTTTGGGTAAAGAAATGGGTTGACTATTCTTCG
AAATATGGTCTTGGCTACTATCTTTCAAATGAAGTAACTGGAGTGTTTTTCAACGATTCG
ACAAAGATAGTCCTAGATCCTAATGGCTATCACTTTGATTATTTCGAGAGACGTAGCTCA
GATCGACAGGACATTGGAAAAGAGTGCACACTCACCGAGTATCCCAAGGAGCTTCAAAAG
AAAGTTACTTTACTCTAACATTTCAGAAGTTATCTAGAGGGAAGTGAAAAGCCAAAACCC
ACCGATCCACCTGCTATCGAGGAAGGCATACTTCCAGAGAGAAAAGTGAAAGATGTCGTT
TACGTTAAGAAATGGATGCGTACTAGACATGCTATCATGTTCAGACTCTCCAATAAAGTT
GTGCAAGTGAACTTTTAGGATCACACTGAGATCATGCTTTCCAGTGAGACTAAAGTGGTA
ACTTACGTCAACAAAAAAGGAGAGAGAAGTACCTATCCTCTAAGTAGCGCCATGGAATCA
GCAAACCTAGAAATGGTGAAGAGACTTAAGTATACCAAGGATATTCTCACTCATATGTTA
AACGCTAATACAAACACTGGCAAGCCTATATCGAACAATGATATTGGCAGTAACTTGGGA
GGTAACACTTAATCCTAAAGCAGCAGACCAAAAACTAACGCATTTGGCAGCGGACTTGAC
TAAAACTCAAAGGGTTAAGTGAGCTCATCAAATAAATTCTCCCCAACTGACAGAGCTGGT
AACAAGCCATATTAGACATCTTAAGGCTTCAACCCAGGCGGTTTAGACGAATGA


>Contig14897.0.1.g59(protein)
MSQKPQSSRSKDNLQQDNNAQIIVEEKVVKFNGDVCIKKYLRGKFLGKGGFAKCYEFTNL
ETKRLSAAKVIAKTSLTKSRAKQKLMSEIKIHRSLHHNNIVGFEHFFEDAENVYILLELC
HNQSLNELLRRRKRLHELEAQCYVNQICAAVKYLHSHRVIHRDLKLGNLFLNDKMEIKIG
DFGLATKLEFDGERKRTICGTPNYIAPEVLEGKQGHSYEVDIWSLGVIIYTLIIGKPPFE
TSDVKTTYKRIRMNAYSFPENVPISDAARDLITKILNNDPSKRPTVDDILNHEFISNGGT
IPRLLPASTLACPPSSTYIRQFLPQSQNQNGKNSTGQQQLTNTAPIKSNDLISGRDKKNA
TDRLSAQPIGSKPISKDVNRPYTDQLETEVWVKKWVDYSSKYGLGYYLSNEVTGVFFNDS
TKIVLDPNGYHFDYFERRSSDRQDIGKECTLTEYPKELQKKVTLLQHFRSYLEGSEKPKP
TDPPAIEEGILPERKVKDVVYVKKWMRTRHAIMFRLSNKVVQVNFQDHTEIMLSSETKVV
TYVNKKGERSTYPLSSAMESANLEMVKRLKYTKDILTHMLNANTNTGKPISNNDIGSNLG
GNTQSQSSRPKTNAFGSGLDQNSKGQVSSSNKFSPTDRAGNKPYQTSQGFNPGGLDE