Identifiers and Description

Gene Model Identifier

Contig14878.0.g72

Standard Name

None

Aliases

Contig14878_0_g72

Description

E2F/DP family winged-helix DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02319 ) E2F/DP family winged-helix DNA-binding domain
  • ( pfam01978 ) Sugar-specific transcriptional regulator TrmB
  • ( pfam04182 ) B-block binding subunit of TFIIIC

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010769506.002718307283067e-26transcription factor E2F/dimer
isation partner...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14878.0.g72(coding)
ATGGACTCCTTCCCTATCATTTCGTTAGATGGTTAACCACAAACCTAAGTTTATAACAAA
TCAAATACTATTTAGATCAAACAGACCGCTAATAACTTAGGTGTTAGCAGAGCTAATGCT
AATGTATTTAAGATGGTCAGCGGAAAGATTGCTAATTTGAAGTATAATAAGAAAGATAAA
TTTGCTTAAAGTCTAAGTATAGGCAATTGTATTGCTTCAACGATACTTGATGAAAATAAT
GTCATTATTTCAAAAGAGTTTTGCCCTGATATAAACTTGAAACCTGACTCAAACTTTAAA
GTAATTCAAATTCCTCTAAAGGATCCTAGCTCTAATAATTCTAACGAAGGCAACGATCAT
CTTCCTGATTTAAAGGGCTCTTAATTACAAATTAATTTAGAGAATTAATCAATCAAGATA
TAGAACTTTTCAGAGAAAGATCACTCTTAAAAGGATCTTCGGTCATCTTCACAAATGTAA
TCATTCACTCAGGGTACATAAAGTCAAAAATATTCACAGCCCTCATAAATTTTCATAGTA
GAAAAGAGAGACATCTCTGATTCATAAAATATCGCTACTTAAAATAAAAGCGAATAGGAC
AAGGATTTTTCTCAGATTCAAACTTAAGATATCAGCTCTAATTGTAGGGCAGAGAAAAGT
TTGGGTGAGATCTGTTTAAAATTTTTAAATTAATTTGGCGCCAAAAACTAAGAAAGGCAA
GTCAACCTAGAGTATTGCGTCCAGGTATTAGGCATTGAAAGACGCCGCATCTACGATATC
GTGAATATACTTGAGAGCTTTGAAATGATCAAGCGCATTCAGAAAAATGTGTATTGTCTT
TCTCCTCCAGAAACCATAAAATCGAGGATATAAGCCTTTGAGGCTAAAGCCTAGTTCAAC
TCAATAAGTTCAGCTTCAACTGAGGAAAAGGGAATTTTTAAATCAGGGATGGAAGAATCT
CAGTGTTCTATGAATTGTATTGAATCAGAGTTGAGTCAAAGCTTGATTTCCATAAAAACT
AAAAGACACAAGTCACTAGGAGTTTTGACTTTGATTTTTATTTAACTATTTTTGAAAAAG
GGTCCAATAATGTCTCTTGATGAGGCTGCAGATAACATCTTTGAGGAGACTTAAGATGGG
TAATCATTATTTAAATCAAAGAGTCGGAGATTGTACGATATTGCAAACGTACTTAAATCC
CTAGGGATTATTAAGAAATAAAAGGATGACAAAAATAAAAATGTCTTCCTTTGGATAGGT
TCTAAGGGATTCTCACTTGAACAGAAGTCTAAGTAAAAATTATAAACCGCCTAATTTTAG
CCAGAAAACAAGGAAATTAACTAACCCTTGATATCAGACTAACCTAAATAAACCTTAAAT
TAAAACAGAATTAATGAAACTGTACCTCAGGAATTTGTGGTAAAAATTGAAAATTATTAA
GCAAATAATTCAGAAATGAGGGCTCCTAAAAACGTTGTGAGCTCTTAACTATTTGAACAA
ACTATTAAATACTCTGGCAATACCAGTTTCGTTTCTTTGAAAGATAAGCAAATAAATTCA
TCTTCAGTTTCAGCAAATAGACTTAATCTTAATAAATCCTAAAGTTTGGAAATCAACAGC
TAGCATTAATCTTTGGAATCTTAAAATCCTTCCTCAAATAAAACTTCTAGCATTAAACAA
TACCCTCAAAACTATTTTGATTTGAAGTCCCAATACAACTTTGACAAGCCTGAGTAGACT
GGGTAGGAAGCTATTCTAAAGAAGCGCCTGTTTTAAGATTCATAAGAAGTCATAAATGGT
AAATTATCAATCTTACTAGAAGCAATAAAGAGACCTAATATAGGTCTTCAAAACTAGAGA
AGTACTCTACACTGCCCAAAACCTGTTTATAAACATCAGTAACAATGA


>Contig14878.0.g72(protein)
MDSFPIISLDGQPQTQVYNKSNTIQIKQTANNLGVSRANANVFKMVSGKIANLKYNKKDK
FAQSLSIGNCIASTILDENNVIISKEFCPDINLKPDSNFKVIQIPLKDPSSNNSNEGNDH
LPDLKGSQLQINLENQSIKIQNFSEKDHSQKDLRSSSQMQSFTQGTQSQKYSQPSQIFIV
EKRDISDSQNIATQNKSEQDKDFSQIQTQDISSNCRAEKSLGEICLKFLNQFGAKNQERQ
VNLEYCVQVLGIERRRIYDIVNILESFEMIKRIQKNVYCLSPPETIKSRIQAFEAKAQFN
SISSASTEEKGIFKSGMEESQCSMNCIESELSQSLISIKTKRHKSLGVLTLIFIQLFLKK
GPIMSLDEAADNIFEETQDGQSLFKSKSRRLYDIANVLKSLGIIKKQKDDKNKNVFLWIG
SKGFSLEQKSKQKLQTAQFQPENKEINQPLISDQPKQTLNQNRINETVPQEFVVKIENYQ
ANNSEMRAPKNVVSSQLFEQTIKYSGNTSFVSLKDKQINSSSVSANRLNLNKSQSLEINS
QHQSLESQNPSSNKTSSIKQYPQNYFDLKSQYNFDKPEQTGQEAILKKRLFQDSQEVING
KLSILLEAIKRPNIGLQNQRSTLHCPKPVYKHQQQ