Identifiers and Description

Gene Model Identifier

Contig14871.0.0.g77

Standard Name

None

Aliases

Contig14871_0_0_g77

Description

UvrD-like helicase C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam13361 ) UvrD-like helicase C-terminal domain
  • ( pfam00580 ) UvrD/REP helicase N-terminal domain
  • ( pfam13538 ) Family description
  • ( pfam01443 ) Viral (Superfamily 1) RNA helicase
  • ( pfam04064 ) Domain of unknown function (DUF384)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJL092W1.9993007828132465e-27SRS2 SGDID:S000003628, Chr X f
rom 257423-260947, Genome...
T. thermophilaTTHERM_008294400.000000000000008995967261938872UvrD/REP helicase family prote
in

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14871.0.0.g77(coding)
ATGAAGGAGAGAGTTTAGACATTGCAATAAAAATAATTTGTAACTTTGCCATGGATTGGA
ACTTTTCATTCTCTTTCAATCAGGCTACTCAAAATGTTCGATAGTTTTACATCAGTTGGT
CTAAAAATGAACTTTAAGTTTGTGGATGAAGACGAAAAATGCTCATTTGTCAAAAATCTT
TTAGATATTCTCCCTGACTAAAATCTAAGAGAGAAACTCAAATGCTTACAATCTAATCCA
AGAGAAAATCTCGAGAAAAGTGTGTGTAATTCAATCAGTAATTTGAAATGTAATGTGAAG
TTCCCAAATGATAATTTGTAAGATCAATTTTCAGGGTTTGATAAGCTAGTTCATCAGACA
ATCTATCCTGTTTACCAGAAATAGTTGTAAGAAGACAACTAATTTGACTTTGACGATATG
CTTTTGAAGTTAGTTTAACTTCCACAGACAAAGCCAAAAAAGTTCAAGTTATTGTAGAAA
CAGTTCAAGTATATCCTTGTTGATGAAGTTTAAGACTTAAATAATCTATAAGAAACTTGG
TTAAAATACATGGCTGGAGATGGGAGAGGACTGACTTGTGTGGGTGATGATGATTAGTTG
ATATACGGCTTTCAAGGAGCAACAGGAAATTTGATTTAAAATTTCAAGAAAACCTATCCA
GAATCCTATATTATCAAGTTGGAGTAAAATTACAGGTCTACTAAATCACTAATTGATTCA
GCAAATAATCTTATTGAGTTCAACAACTGTAGGATTAATAAGAAATTATGGACATAGAAC
TCACAAGGGTAGCCTCCACAAATCACATAATATTAGACAAATAAAGATGAGATAAAAGAA
ATTGTTAAGTAAATCAAACTTATGATTAGTAATTATCAAAATTAAAGAAGACTCTAATCC
TTTGGAAGCTATGGTAATTAAGAGTAGGTTGTAGGAAGCTAAATTGCTATATTAACAAGA
ACGAATAAGCAAGCATAAAACTTTGAAGAGCTACTAAGAGAGCATGATGTCCCCTATGAA
ATGCCAAAGAAATCAATGAACTTTCTCAAAAAAGAGGAAATACAACTTGCTTTGAAATTC
TTGACAATACTCTATGATTAAGGAAACGATGAAATATTAAGTGATATTATTTTAAAACTC
AAGGGTTTTGGGAAAATAACAGTCAAGAAATTGTTGGAAAATGCATCTTAATAGAAATAA
AGCTTGCTTAAATACTGTCAAATACTTTTGGGTATGGAGATTGGGGATGATCAAGAGAGA
AATAATTTACAATAATAAAATTTGATAAACAAAGTTAATTTGCAAGACTAGAATTCTCAT
GAGGATAAAAAAGCTCAAGAGGAAAACAAAGAGGAGACGATTGTGTTTTAAGATGAAATT
TTTTTTCATAATTTGGAATTGAAATCTACGTAATCTTAATCTGATTGTGAAGACACAGAT
AATCAGCAGTTATTATCTGTAATTCACTAGATCAACAGATAGGAGAGAAGGTCTAAGTCT
AAATCCAAATTTCAAAGTCAAATTATCAAGCTAAATTCAAACCAAAAAGACTCTCTCAAA
TACTTTCTCTTAATCCTATAAAATCACATAAACTAAAGAGAGAATTTATTAGATTACATC
TCCCTCTAGAAATACCTTAGAGACGCAGGATTTTACTATATGTTGAAGAAATATTATAAG
AACTACAAAGTTGCCAAAGAGAGAATTTAAGAGTTGCTTGAAAGAGTAGGGAAGTTTAGT
GATTTTGAGAGCTTCATTTTGTATATCAAAGGATTGAACGAAATTAAGAATATTTAAGAA
GAGAATATTGATAGAGTACATAAAATCAAGTTATTGACTATCCATTCTGCAAAAGGCCTT
GAATTTGACTATGTGTTTCTTCCATTTTGGAACCAGAATGACCTACCCTTCAAATTCAAA
GACCCAGACGTAACACAAGACGAGCATGAAGAATCAGAGAGAAGATTAGCTTTTGTAGCT
TTGACTCGTGCCAGAAAGCATGCGTATATTTCATGTTCAAGCGTATATGTAGACTAGAAG
TTTACCAGGAAAATCTAACCTTCTCAATTCATACAAGAAGTCAAGTGA


>Contig14871.0.0.g77(protein)
MKERVQTLQQKQFVTLPWIGTFHSLSIRLLKMFDSFTSVGLKMNFKFVDEDEKCSFVKNL
LDILPDQNLREKLKCLQSNPRENLEKSVCNSISNLKCNVKFPNDNLQDQFSGFDKLVHQT
IYPVYQKQLQEDNQFDFDDMLLKLVQLPQTKPKKFKLLQKQFKYILVDEVQDLNNLQETW
LKYMAGDGRGLTCVGDDDQLIYGFQGATGNLIQNFKKTYPESYIIKLEQNYRSTKSLIDS
ANNLIEFNNCRINKKLWTQNSQGQPPQITQYQTNKDEIKEIVKQIKLMISNYQNQRRLQS
FGSYGNQEQVVGSQIAILTRTNKQAQNFEELLREHDVPYEMPKKSMNFLKKEEIQLALKF
LTILYDQGNDEILSDIILKLKGFGKITVKKLLENASQQKQSLLKYCQILLGMEIGDDQER
NNLQQQNLINKVNLQDQNSHEDKKAQEENKEETIVFQDEIFFHNLELKSTQSQSDCEDTD
NQQLLSVIHQINRQERRSKSKSKFQSQIIKLNSNQKDSLKYFLLILQNHINQRENLLDYI
SLQKYLRDAGFYYMLKKYYKNYKVAKERIQELLERVGKFSDFESFILYIKGLNEIKNIQE
ENIDRVHKIKLLTIHSAKGLEFDYVFLPFWNQNDLPFKFKDPDVTQDEHEESERRLAFVA
LTRARKHAYISCSSVYVDQKFTRKIQPSQFIQEVK